FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP81_ORYSJ (Heat shock protein 81-1 OS=Oryza sativa subsp. japonica GN=HSP81-1 PE=2 SV=2)

HSP 1 Score: 398.282 bits (1022), Expect = 2.184e-110
Identity = 204/240 (85.00%), Postives = 209/240 (87.08%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDSTN+ K+AELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKK KE LKEKFEGLCKVIK+VLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IMEELRKRADADKNDKSVKD           TSG SLD
Sbjct:  413 AFSKNLKLGIHEDSTNRNKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLD 652          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP81_ORYSI (Heat shock protein 81-1 OS=Oryza sativa subsp. indica GN=HSP81-1 PE=2 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 2.184e-110
Identity = 204/240 (85.00%), Postives = 209/240 (87.08%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDSTN+ K+AELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKK KE LKEKFEGLCKVIK+VLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IMEELRKRADADKNDKSVKD           TSG SLD
Sbjct:  413 AFSKNLKLGIHEDSTNRNKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLD 652          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_ORYSJ (Heat shock protein 81-3 OS=Oryza sativa subsp. japonica GN=HSP81-3 PE=2 SV=2)

HSP 1 Score: 392.504 bits (1007), Expect = 1.199e-108
Identity = 200/240 (83.33%), Postives = 210/240 (87.50%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDSTN+TK+AELLRYHSTKSGDELTSLKDYVTRMKEGQ++IYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKK +E LKEKFEGLCKVIK+VLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IM+ELRKRADADKNDKSVKD           TSG SL+
Sbjct:  413 AFSKNLKLGIHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQSEIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEKFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLE 652          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP82_ORYSJ (Heat shock protein 81-2 OS=Oryza sativa subsp. japonica GN=HSP81-2 PE=2 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.199e-108
Identity = 200/240 (83.33%), Postives = 210/240 (87.50%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDSTN+TK+AELLRYHSTKSGDELTSLKDYVTRMKEGQ++IYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKK +E LKEKFEGLCKVIK+VLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IM+ELRKRADADKNDKSVKD           TSG SL+
Sbjct:  413 AFSKNLKLGIHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQSEIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEKFEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLE 652          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP82_ARATH (Heat shock protein 81-2 OS=Arabidopsis thaliana GN=HSP81-2 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.565e-108
Identity = 200/240 (83.33%), Postives = 208/240 (86.67%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDS N+TK+AELLRYHSTKSGDELTSLKDYVTRMKEGQNDI+YITGESKKAVENSPFLEKLKKKG EVLYMVDAIDEYA+GQLKEFEGKKLVSATKEGLKLDE+EDEKK KE LKEKFEGLCKVIKDVLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IM+ELRKRADADKNDKSVKD           TSG SLD
Sbjct:  411 AFSKNLKLGIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLD 650          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_ARATH (Heat shock protein 81-3 OS=Arabidopsis thaliana GN=HSP81-3 PE=2 SV=2)

HSP 1 Score: 390.578 bits (1002), Expect = 4.554e-108
Identity = 199/240 (82.92%), Postives = 207/240 (86.25%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDS N+TK+AELLRYHSTKSGDELTSLKDYVTRMKEGQNDI+YITGESKKAVENSPFLEKLKKKG EVLYMVDAIDEYA+GQLKEFEGKKLVSATKEGLKLDE+EDEKK KE LKEKFEGLCKVIKDVLG               PCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTMEINPEN IM+ELRKRADADKNDKSVKD           TSG SLD
Sbjct:  411 AFSKNLKLGIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLD 650          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP80_SOLLC (Heat shock cognate protein 80 OS=Solanum lycopersicum GN=HSC80 PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.325e-107
Identity = 197/240 (82.08%), Postives = 207/240 (86.25%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDS N+ K AELLRYHSTKSGDE+TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEY++GQLKEFEGKKLVSATKEGLKLDESEDEKK +E LKEKFEGLCKV+KDVLG               PCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTMEINPEN IM+ELRKRADADKNDKSVKD           TSG SL+
Sbjct:  411 AFSKNLKLGIHEDSQNRAKFAELLRYHSTKSGDEMTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKVMKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLE 650          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP82_TOBAC (Heat shock protein 82 (Fragment) OS=Nicotiana tabacum GN=HSP82 PE=2 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 3.161e-101
Identity = 187/241 (77.59%), Postives = 203/241 (84.23%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDS N+ KLA+LLRYHSTKSGDE+TSLKDYVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVLYMVDAIDEYAVGQLKE++GKKLVSATKEGLKL D+SE+EKK KE  K+ FE LCK+IKD+LG               PCCLVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKSVKD           TSG SLD
Sbjct:  212 AFSKNLKLGIHEDSQNRAKLADLLRYHSTKSGDEMTSLKDYVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDDSEEEKKKKEEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLD 452          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP83_IPONI (Heat shock protein 83 OS=Ipomoea nil GN=HSP83A PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.735e-99
Identity = 184/241 (76.35%), Postives = 202/241 (83.82%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDS N+ KLA+LLRY+STKSGDELTSLKDYVTRMKEGQ DIYYITGESKKAVENSPFLE+LKKKGYEVL+MVDAIDEYAVGQLKE++GKKLVSATKEGLKL D+ E+EKK +E  K+ FE LCK+IKD+LG               PCCLVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKTMEINP+N IMEELRKRA+ADKNDKSVKD           TSG SLD
Sbjct:  416 AFSKNLKLGIHEDSQNRAKLADLLRYYSTKSGDELTSLKDYVTRMKEGQKDIYYITGESKKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDDDEEEKKKREEKKKSFENLCKIIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLD 656          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HSP81_ARATH (Heat shock protein 81-1 OS=Arabidopsis thaliana GN=HSP81-1 PE=1 SV=3)

HSP 1 Score: 360.533 bits (924), Expect = 5.047e-99
Identity = 182/241 (75.52%), Postives = 202/241 (83.82%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +FSKNLKLGIHEDS N+ K+A+LLRYHSTKSGDE+TS KDYVTRMKEGQ DI+YITGESKKAVENSPFLE+LKK+GYEVLYMVDAIDEYAVGQLKE++GKKLVSATKEGLKL DE+E+EKK +E  K+ FE LCK IK++LG               PCCLVTGEYGWTANMERIMKAQALRD+SM+GYMSSKKTMEINP+N IMEELRKRA+ADKNDKSVKD           TSG SLD
Sbjct:  412 AFSKNLKLGIHEDSQNRGKIADLLRYHSTKSGDEMTSFKDYVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLD 652          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HSP81_ORYSJ2.184e-11085.00Heat shock protein 81-1 OS=Oryza sativa subsp. jap... [more]
HSP81_ORYSI2.184e-11085.00Heat shock protein 81-1 OS=Oryza sativa subsp. ind... [more]
HSP83_ORYSJ1.199e-10883.33Heat shock protein 81-3 OS=Oryza sativa subsp. jap... [more]
HSP82_ORYSJ1.199e-10883.33Heat shock protein 81-2 OS=Oryza sativa subsp. jap... [more]
HSP82_ARATH1.565e-10883.33Heat shock protein 81-2 OS=Arabidopsis thaliana GN... [more]
HSP83_ARATH4.554e-10882.92Heat shock protein 81-3 OS=Arabidopsis thaliana GN... [more]
HSP80_SOLLC1.325e-10782.08Heat shock cognate protein 80 OS=Solanum lycopersi... [more]
HSP82_TOBAC3.161e-10177.59Heat shock protein 82 (Fragment) OS=Nicotiana taba... [more]
HSP83_IPONI1.735e-9976.35Heat shock protein 83 OS=Ipomoea nil GN=HSP83A PE=... [more]
HSP81_ARATH5.047e-9975.52Heat shock protein 81-1 OS=Arabidopsis thaliana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top