FC931317

Overview
NameFC931317
Unique NameFC931317
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10833 contig Ccv1_Contig10833:822..1532. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931317 vs. ExPASy Swiss-Prot
Match: TM87A_XENTR (Transmembrane protein 87A OS=Xenopus tropicalis GN=tmem87a PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.766e-33
Identity = 67/210 (31.90%), Postives = 125/210 (59.52%), Query Frame = 1
Query:    4 LGLFEIILWFSEYANFNNTGIRPVVITTWVVTVGAVRKSLTRLLILCVSMGYGVVRPTLGGLTSKVLLLGATYFLASELLDITEFVGTIS-DISGRARLFLVLPVAFLDAFLILWIFTSLSKTLEQLQAKRSSIKLDIYRKFSNALAVTVIASVIWIAYEVYFKATDPFNERWQSAWIITAFWDVLAFALLCVICYLWAPSQNSQRYAYS 630
            LG+ E  ++++EY N +NTG+    +  +   + +++++L RLL+  VS+GYG+++P LG +  +V+ +G  YF+ + +  +   +G    D+     L   +P+A LD+ L  WIF SL++T++ L+ +++++K  +YR F+N L   ++AS+I++ +             W   W+  A+W  L F +L VI +LW PS N+QRYA++
Sbjct:  252 LGMLEKAVYYAEYQNTDNTGVSSHGLLIFAELISSIKRTLARLLVTIVSLGYGIIKPRLGAVMHRVVGMGVLYFVFAAVEGVMRIIGAKEYDLV----LLAGIPLALLDSGLCWWIFVSLAQTMKTLKLRKNTVKYSLYRHFTNTLIFAILASIIFMIWRTKKFQLVDCQADWMELWVDDAYWRFLFFIILLVIMFLWRPSANNQRYAFT 457          
BLAST of FC931317 vs. ExPASy Swiss-Prot
Match: TM87A_MOUSE (Transmembrane protein 87A OS=Mus musculus GN=Tmem87a PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.047e-33
Identity = 74/209 (35.41%), Postives = 119/209 (56.94%), Query Frame = 1
Query:    4 LGLFEIILWFSEYANFNNTGIRPVVITTWVVTVGAVRKSLTRLLILCVSMGYGVVRPTLGGLTSKVLLLGATYFLASELLDITEFVGTISDISGRARLFLVLPVAFLDAFLILWIFTSLSKTLEQLQAKRSSIKLDIYRKFSNALAVTVIASVIWIAYEVYFKATDPFNERWQSAWIITAFWDVLAFALLCVICYLWAPSQNSQRYAYS 630
            LG+FE  ++++E+ N    G            + AV++SL R L++ VS+GYG+V+P LG    KV++ GA Y L S +  +    G  +D++  A     +P+AFLD  L  WIF SL++T++ L+ +R+ +KL +YR F+N L + V AS+++I +             W+  W+  A W +L   +L VI  LW PS N+QR+A+S
Sbjct:  268 LGMFEKAVFYAEFQNIRYKGESVQNALVLAELLSAVKRSLARTLVIIVSLGYGIVKPRLGVTLHKVVVAGALYLLFSGMEGVLRVTGAQTDLASLA----FIPLAFLDTALCWWIFISLTQTMKLLKLRRNIVKLSLYRHFTNTLILAVAASIVFIIWTTMKFRIVTCQSDWRELWVDDAIWRLLFSMILFVIMILWRPSANNQRFAFS 472          
BLAST of FC931317 vs. ExPASy Swiss-Prot
Match: TM87B_MOUSE (Transmembrane protein 87B OS=Mus musculus GN=Tmem87b PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.051e-32
Identity = 69/211 (32.70%), Postives = 123/211 (58.29%), Query Frame = 1
Query:    4 LGLFEIILWFSEYANFNNTGIRPVVITTWVVTVGAVRKSLTRLLILCVSMGYGVVRPTLGGLTSKVLLLGATYFLASELLDITEFVGTISDISGRARLFLVLP---VAFLDAFLILWIFTSLSKTLEQLQAKRSSIKLDIYRKFSNALAVTVIASVIWIAYEVYFKATDPFNERWQSAWIITAFWDVLAFALLCVICYLWAPSQNSQRYAY 627
            LG+ E  +++SEY N N+TG+    +  +   + AV+++L RLL++ VS+GYG+V+P LG +  +V+ LG  Y + + +  +   +G      G   L +VL    +A +D+  + +IF SL++T++ L+ +++++K  +YR F+N L   V+AS++++ +             W   W+  AFW  L   +L VI +LW PS N+QRYA+
Sbjct:  259 LGMLEKAVFYSEYQNINSTGLSTQGLLIFAELISAVKRTLARLLVIIVSLGYGIVKPRLGTVMHRVIGLGLLYLIFAAIEGVMRVIG------GSKHLAVVLTDIVLAVIDSIFVWFIFISLAQTMKTLRLRKNTVKFSLYRHFTNTLIFAVLASIVFMVWTTKTFRIAKCQSDWMELWVDDAFWSFLFSVILIVIMFLWRPSANNQRYAF 463          
BLAST of FC931317 vs. ExPASy Swiss-Prot
Match: TM87B_HUMAN (Transmembrane protein 87B OS=Homo sapiens GN=TMEM87B PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 3.994e-32
Identity = 68/211 (32.23%), Postives = 122/211 (57.82%), Query Frame = 1
Query:    4 LGLFEIILWFSEYANFNNTGIRPVVITTWVVTVGAVRKSLTRLLILCVSMGYGVVRPTLGGLTSKVLLLGATYFLASELLDITEFVGTISDISGRARLFLVLP---VAFLDAFLILWIFTSLSKTLEQLQAKRSSIKLDIYRKFSNALAVTVIASVIWIAYEVYFKATDPFNERWQSAWIITAFWDVLAFALLCVICYLWAPSQNSQRYAY 627
            LG+ E  +++SEY N +NTG+    +  +   + A++++L RLL++ VS+GYG+V+P LG +  +V+ LG  Y + + +  +   +G      G   L +VL    +A +D+  + +IF SL++T++ L+ +++++K  +YR F N L   V+AS++++ +             W   W+  AFW  L   +L VI +LW PS N+QRYA+
Sbjct:  258 LGMLEKAVFYSEYQNISNTGLSTQGLLIFAELISAIKRTLARLLVIIVSLGYGIVKPRLGTVMHRVIGLGLLYLIFAAVEGVMRVIG------GSNHLAVVLDDIILAVIDSIFVWFIFISLAQTMKTLRLRKNTVKFSLYRHFKNTLIFAVLASIVFMGWTTKTFRIAKCQSDWMERWVDDAFWSFLFSLILIVIMFLWRPSANNQRYAF 462          
BLAST of FC931317 vs. ExPASy Swiss-Prot
Match: TM87A_HUMAN (Transmembrane protein 87A OS=Homo sapiens GN=TMEM87A PE=1 SV=3)

HSP 1 Score: 137.887 bits (346), Expect = 5.216e-32
Identity = 73/209 (34.93%), Postives = 118/209 (56.46%), Query Frame = 1
Query:    4 LGLFEIILWFSEYANFNNTGIRPVVITTWVVTVGAVRKSLTRLLILCVSMGYGVVRPTLGGLTSKVLLLGATYFLASELLDITEFVGTISDISGRARLFLVLPVAFLDAFLILWIFTSLSKTLEQLQAKRSSIKLDIYRKFSNALAVTVIASVIWIAYEVYFKATDPFNERWQSAWIITAFWDVLAFALLCVICYLWAPSQNSQRYAYS 630
            LG+ E  ++++E+ N    G            + AV++SL R L++ VS+GYG+V+P LG    KV++ GA Y L S +  +    G  +D++  A     +P+AFLD  L  WIF SL++T++ L+ +R+ +KL +YR F+N L + V AS+++I +             W+  W+  A W +L   +L VI  LW PS N+QR+A+S
Sbjct:  268 LGMLEKAVFYAEFQNIRYKGESVQGALILAELLSAVKRSLARTLVIIVSLGYGIVKPRLGVTLHKVVVAGALYLLFSGMEGVLRVTGAQTDLASLA----FIPLAFLDTALCWWIFISLTQTMKLLKLRRNIVKLSLYRHFTNTLILAVAASIVFIIWTTMKFRIVTCQSDWRELWVDDAIWRLLFSMILFVIMVLWRPSANNQRFAFS 472          
BLAST of FC931317 vs. ExPASy Swiss-Prot
Match: YEG7_SCHPO (Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe GN=SPAC26H5.07c PE=2 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.434e-13
Identity = 46/181 (25.41%), Postives = 89/181 (49.17%), Query Frame = 1
Query:  106 AVRKSLTRLLILCVSMGYGVVRPTLGGLTSKVLLLGATYFLASELLDITEFVGTISDISGRARLFLVLPVAFLDAF-LILWIFTSLSKTLEQLQAKRSSIKLDIYRKFSNALAVTVIASVIWIAYEV----YFKATDPFNERWQSAWIIT-AFWDVLAFALLCVICYLWAPSQNSQRYAYS 630
            + R+S    L+L VS+GY +V P+LG L  K  +L    F++S     + F+   +  S    +    PV  +  F + LWI  +L+ T+  L+ ++ ++K  +Y +    +   ++A    +A        +   + + + W+  W +   + D+L   L+  I YLW P++N++R+A S
Sbjct:  258 SARQSYFGFLLLIVSLGYSIVVPSLGSLLRKCQILAGLQFVSSCFFLSSLFISPSNKES--LVILFAAPVFLITLFAMFLWIVLALNNTIRDLRIRKQTVKAQMYTRLWIVICFGIVAYASIVAANAILIGIYGQMNYYLKYWKLLWFLNYGYTDILVLILMLTILYLWRPTENNRRFAMS 436          
BLAST of FC931317 vs. ExPASy Swiss-Prot
Match: PTM1_YEAST (Membrane protein PTM1 OS=Saccharomyces cerevisiae GN=PTM1 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.691e-12
Identity = 55/206 (26.70%), Postives = 102/206 (49.51%), Query Frame = 1
Query:   52 NNTGIRPVVITTWVVTVGAVRKSLTRLLILCVSMGYGVVRPTLGG-LTSKVLLLGA-TYFLASELLDITEFVGTISDISGRARLFLVLPVAFLDAFLILW--IFTSLSKTLEQLQAKRSSIKLDIYRK--------FSNALAVTVIASVIWIAYEVYFKATDPFNERWQSAWIITAFWDVLAFALLCV-ICYLWAPSQNSQRYAYS 630
            +  GI+  ++   ++T G V  S    L+L +++GYG+V P L   L  +  + GA TY +    L        ++D+   + L L+  +    A +I +  I  S++KT+  L+ +R  +KL++Y+K        F + LA ++++S I++         D   + W+S + +T FW  L + ++ V I +LW P+  S   A S
Sbjct:  257 DTAGIKVYMVFLSILTAGKVTFSF--FLLLIIALGYGIVYPKLNKTLMRRCQMYGALTYAICIGFL----IQSYLTDMEAPSPLILITLIPMALALIIFYYMIIRSMTKTVIYLKEQRQIVKLNMYKKLLYIIYASFLSVLAGSIVSSFIYVG----MNTIDMIEKNWRSRFFVTDFWPTLVYFIVFVTIAFLWRPTDTSYMLAAS 452          
BLAST of FC931317 vs. ExPASy Swiss-Prot
Match: PTM1_YEAS7 (Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PTM1 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.691e-12
Identity = 55/206 (26.70%), Postives = 102/206 (49.51%), Query Frame = 1
Query:   52 NNTGIRPVVITTWVVTVGAVRKSLTRLLILCVSMGYGVVRPTLGG-LTSKVLLLGA-TYFLASELLDITEFVGTISDISGRARLFLVLPVAFLDAFLILW--IFTSLSKTLEQLQAKRSSIKLDIYRK--------FSNALAVTVIASVIWIAYEVYFKATDPFNERWQSAWIITAFWDVLAFALLCV-ICYLWAPSQNSQRYAYS 630
            +  GI+  ++   ++T G V  S    L+L +++GYG+V P L   L  +  + GA TY +    L        ++D+   + L L+  +    A +I +  I  S++KT+  L+ +R  +KL++Y+K        F + LA ++++S I++         D   + W+S + +T FW  L + ++ V I +LW P+  S   A S
Sbjct:  257 DTAGIKVYMVFLSILTAGKVTFSF--FLLLIIALGYGIVYPKLNKTLMRRCQMYGALTYAICIGFL----IQSYLTDMEAPSPLILITLIPMALALIIFYYMIIRSMTKTVIYLKEQRQIVKLNMYKKLLYIIYASFLSVLAGSIVSSFIYVG----MNTIDMIEKNWRSRFFVTDFWPTLVYFIVFVTIAFLWRPTDTSYMLAAS 452          
The following BLAST results are available for this feature:
BLAST of FC931317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
TM87A_XENTR2.766e-3331.90Transmembrane protein 87A OS=Xenopus tropicalis GN... [more]
TM87A_MOUSE8.047e-3335.41Transmembrane protein 87A OS=Mus musculus GN=Tmem8... [more]
TM87B_MOUSE1.051e-3232.70Transmembrane protein 87B OS=Mus musculus GN=Tmem8... [more]
TM87B_HUMAN3.994e-3232.23Transmembrane protein 87B OS=Homo sapiens GN=TMEM8... [more]
TM87A_HUMAN5.216e-3234.93Transmembrane protein 87A OS=Homo sapiens GN=TMEM8... [more]
YEG7_SCHPO2.434e-1325.41Uncharacterized protein C26H5.07c OS=Schizosacchar... [more]
PTM1_YEAST2.691e-1226.70Membrane protein PTM1 OS=Saccharomyces cerevisiae ... [more]
PTM1_YEAS72.691e-1226.70Membrane protein PTM1 OS=Saccharomyces cerevisiae ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34103G12EF PostHarvP1 Citrus clementina cDNA clone C34103G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931317 ID=FC931317|Name=FC931317|organism=Citrus clementina|type=EST|length=710bp
ACTCTCGGATTGTTTGAGATCATTCTTTGGTTTTCTGAGTATGCAAATTT
TAATAACACAGGAATTAGACCAGTTGTAATTACAACTTGGGTTGTGACAG
TTGGAGCAGTAAGAAAATCACTTACTCGCCTTCTTATTCTCTGTGTTTCA
ATGGGCTATGGGGTTGTGCGGCCCACTCTTGGCGGCCTTACCTCAAAGGT
GCTTCTTCTGGGTGCGACATACTTTTTGGCATCTGAGTTGCTGGATATTA
CTGAGTTTGTTGGAACCATCAGCGACATATCCGGAAGAGCAAGACTTTTT
CTTGTTCTTCCTGTTGCATTCTTGGATGCCTTTTTGATATTGTGGATTTT
TACTTCTCTTTCAAAGACACTGGAGCAGCTGCAGGCAAAAAGGAGTTCTA
TCAAGTTGGATATATATAGGAAGTTCTCAAATGCATTAGCTGTGACAGTC
ATTGCTTCAGTTATTTGGATAGCTTATGAGGTGTATTTCAAAGCAACAGA
TCCTTTCAATGAGCGATGGCAGAGTGCTTGGATCATTACTGCTTTCTGGG
ACGTTCTTGCCTTTGCCTTGCTATGTGTTATTTGCTATCTGTGGGCCCCA
TCTCAGAACTCCCAAAGGTACGCCTACTCGGAGGAAGTGGGAGAAGAATA
TGATGAAGAAACTCAGTCTTTAACAGGGGGCAGCCAGAAGGTGATCTTAG
TTTAGTCAAG
back to top