FC931320

Overview
NameFC931320
Unique NameFC931320
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11747 contig Ccv1_Contig11747:528..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: METB_ARATH (Cystathionine gamma-synthase, chloroplastic OS=Arabidopsis thaliana GN=CGS1 PE=2 SV=3)

HSP 1 Score: 409.068 bits (1050), Expect = 1.247e-113
Identity = 194/233 (83.26%), Postives = 215/233 (92.27%), Query Frame = 2
Query:    2 PKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGCISGSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDL 700
            PK+GIT TVIDPAD+ GLEAA+N   VSLFFTESPTNPFLRCVD++LVS +CHK+G +VCIDGTFATPLNQKAL+LGADLV+HSATK+IGGHNDVLAGCI GS KLV++IRNLHHVLGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA+ILEAHPKV  V+YPGL SHPEH +A +QMTGFGGVVSFE+DGD+  TIKF+D+LKIPYIAPSFGGCESIVDQPAIMSYWDL
Sbjct:  293 PKLGITVTVIDPADIAGLEAAVNEFKVSLFFTESPTNPFLRCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAIMSYWDL 525          
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: METC_LACLM (Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metC PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.189e-47
Identity = 94/230 (40.87%), Postives = 156/230 (67.83%), Query Frame = 2
Query:    5 KMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGCIS-GSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSY 691
            K GI   ++D ++++ L+AA      +++F E+P+NP L+ +D+K +S +     A+  +D TFATP  Q+ ++LGAD+VLHSATK++GGH+DV+AG ++  S++L ++I  L + +G  L P  ++L+ RG+KTL LR++  ++ A ++A+ LE    V +V+YPGL SHP H IA +QM+ FGG++SFE+  D  A   F++ L    +A S GG ES+++ PA+M++
Sbjct:  112 KTGIIYDLVDLSNLDDLKAAFKEETKAIYF-ETPSNPLLKVLDIKEISAIAKAHDALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLVTTNSKELASEIGFLQNSIGAVLGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLNSHPGHEIAKKQMSAFGGMISFELT-DENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTH 339          
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: METC_LACLA (Cystathionine beta-lyase OS=Lactococcus lactis subsp. lactis GN=metC PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.189e-47
Identity = 94/230 (40.87%), Postives = 156/230 (67.83%), Query Frame = 2
Query:    5 KMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGCIS-GSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSY 691
            K GI   ++D ++++ L+AA      +++F E+P+NP L+ +D+K +S +     A+  +D TFATP  Q+ ++LGAD+VLHSATK++GGH+DV+AG ++  S++L ++I  L + +G  L P  ++L+ RG+KTL LR++  ++ A ++A+ LE    V +V+YPGL SHP H IA +QM+ FGG++SFE+  D  A   F++ L    +A S GG ES+++ PA+M++
Sbjct:  112 KTGIIYDLVDLSNLDDLKAAFKEETKAIYF-ETPSNPLLKVLDIKEISAIAKAHDALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLVTTNSKELASEIGFLQNSIGAVLGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLNSHPGHEIAKKQMSAFGGMISFELT-DENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTH 339          
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: METB_HELPY (Cystathionine gamma-synthase OS=Helicobacter pylori GN=metB PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.189e-47
Identity = 94/230 (40.87%), Postives = 149/230 (64.78%), Query Frame = 2
Query:    5 KMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGCIS-GSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSY 691
            K G++ T+ID +D+  ++ A+  N  +L+  E+P+NP L+  D+   + +    G +  +D TFATP  Q  L LGAD+V HS TK++GGH+DV+AG ++  +E L  +I    + +GG L P  ++L+ RG+KTL LR++     AL +A+ LE HPKV+RV+YPGL +HP + +A +QM GF G++SF +  D  A + F+++LK+  +  S GG ES+V  PA M++
Sbjct:  111 KNGLSCTIIDTSDISQIKKAIKPNTKALYL-ETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFATPYYQNPLLLGADIVAHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGPQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRGFSGMLSFTLKNDSEA-VAFVESLKLFILGESLGGVESLVGIPAFMTH 338          
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: METC_LACLC (Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris GN=metC PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.315e-46
Identity = 94/230 (40.87%), Postives = 154/230 (66.96%), Query Frame = 2
Query:    5 KMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGCI-SGSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSY 691
            K GI   ++D +++E L+AA      +++F E+P+NP L+ +D+K +S +     A+  +D TFATP  Q+ ++LGAD+VLHSATK++GGH+DV+AG + + S +L  +I  L + +G  L P  ++L+ RG+KTL  R++  ++ A ++A+ LEA   V +V+YPGL +H  H IA +QMT FGG++SFE+  D  A   F++ L+   +A S GG ES+++ PA+M++
Sbjct:  112 KTGIIYDLVDLSNLEDLKAAFKAETKAVYF-ETPSNPLLKVLDIKEISSIAKAHNALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLVTTNSNELAIEIGFLQNSIGAVLGPQDSWLVQRGIKTLAPRMEAHSANAQKIAEFLEASQAVSKVYYPGLVNHEGHEIAKKQMTAFGGMISFELT-DENAVKNFVENLRYFTLAESLGGVESLIEVPAVMTH 339          
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: MCCB_BACSU (Cystathionine gamma-lyase OS=Bacillus subtilis GN=mccB PE=1 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.996e-46
Identity = 92/237 (38.82%), Postives = 152/237 (64.14%), Query Frame = 2
Query:    5 KMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAG-CISGSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSHRR 712
            ++GI +T +D +  E +E A+  N  +++  E+PTNP L+  D+ L++D+  K G ++ +D TF TP  Q+ L+LGAD+VLHSATK++GGH+DV+ G  ++ S++L  ++  + +  GG L P  ++L++RG+KTL LR++  +  A ++A  LE HP V+ ++YPG  +HP H +A  Q  GFGG++SF++ G       F+  LK+  IA S G  ES++  PA M++  +   R
Sbjct:  111 RLGIESTFVDTSSREEVEKAIRPNTKAIYI-ETPTNPLLKITDLTLMADIAKKAGVLLIVDNTFNTPYFQQPLTLGADIVLHSATKYLGGHSDVVGGLVVTASKELGEELHFVQNSTGGVLGPQDSWLLMRGIKTLGLRMEAIDQNARKIASFLENHPAVQTLYYPGSSNHPGHELAKTQGAGFGGMISFDI-GSEERVDAFLGNLKLFTIAESLGAVESLISVPARMTHASIPRER 345          
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: CGL_DICDI (Cystathionine gamma-lyase OS=Dictyostelium discoideum GN=cysA PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.523e-46
Identity = 86/222 (38.74%), Postives = 143/222 (64.41%), Query Frame = 2
Query:   29 IDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGCIS-GSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSY 691
            +D + ++ L+ A  +    L + E+PTNP L+  D+K V+D  H +GA + +D TF +P  Q  L LGAD+V+HS TK+I GH+D + G ++  +++L  +++ L + +G   +P   +L +RG+KTLH+R++     A  +   LE HPKV+RV YPGL SHP+H I  +QM G+GG+V F V G +  +  F++ +K+  +A S GG ES+++ P++M++
Sbjct:  126 VDLSTLDDLKNAFTDKT-RLVWIETPTNPLLKVADIKAVADYVHSRGATLVVDNTFMSPYFQNPLDLGADIVMHSVTKYINGHSDCVMGVLATNNDELYAKLKFLQNSIGAVPSPFDCFLALRGLKTLHVRMEAHQKNAFAICNFLEKHPKVERVIYPGLPSHPQHEICKRQMKGYGGMVVFFVKGSIDQSRSFLENIKLFALAESLGGVESLIELPSVMTH 346          
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: METC_COXBU (Cystathionine beta-lyase OS=Coxiella burnetii GN=metC PE=1 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.113e-45
Identity = 88/229 (38.43%), Postives = 149/229 (65.07%), Query Frame = 2
Query:   11 GITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGC--ISGSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSY 691
            G++ + +D  D   +  A+      + + ESP+NP L+ VD+  ++++  +K  I   D TFATP+ Q+ L LG D+V HSATK++ GH+D++ G   +  ++ L  Q++ L + +G    P  +++++RG+KTL +R+++    A+++A+ LE HPKVKRV+YPGL SHP+H IA +QM  FGG++S E+  DL  T K ++  ++  +A S GG ES+++ PAIM++
Sbjct:  122 GLSFSFVDFTDENKVREAVTAKT-KMLWVESPSNPRLKIVDLAKIAEIAKEKNIIAVADNTFATPIIQRPLELGFDIVTHSATKYLNGHSDIIGGVAVVGDNKTLAEQLKYLQNAIGAIAAPFDSFMVLRGLKTLAIRMERHCENAMQLAQWLEKHPKVKRVYYPGLPSHPQHSIAKKQMRYFGGMISVELKCDLNETKKVLERCQLFTLAESLGGVESLIEHPAIMTH 349          
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: METB_HELPJ (Cystathionine gamma-synthase OS=Helicobacter pylori J99 GN=metB PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 4.230e-45
Identity = 90/230 (39.13%), Postives = 145/230 (63.04%), Query Frame = 2
Query:    5 KMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGCIS-GSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSY 691
            K G++ T+ID +D+  ++ A+  N  +L+  E+P+NP L+  D+   + +  +   +  +D TFATP  Q  L LG D+V H+ TK++GGH+DV+AG ++  +E L  +     + +GG L    ++L+ RG+KTL LR++     AL +A+ LE HPKV+RV+YPGL +HP H +A  QM GF G+ SF +  D  A + F+++LK+  +  S GG ES+V  PA+M++
Sbjct:  111 KNGLSCTIIDTSDLSQIKKAIKPNTKALYL-ETPSNPLLKITDLAQCASVAKEHNLLTIVDNTFATPYCQNPLLLGTDIVAHNGTKYLGGHSDVVAGLVTTNNEALAQEFDFFQNAIGGVLGLQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNHELAKAQMRGFSGMFSFTLKNDSEA-VAFVESLKLFILGESLGGVESLVGIPALMTH 338          
BLAST of FC931320 vs. ExPASy Swiss-Prot
Match: MEGL_PSEPU (Methionine gamma-lyase OS=Pseudomonas putida GN=mdeA PE=1 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 9.423e-45
Identity = 94/231 (40.69%), Postives = 148/231 (64.07%), Query Frame = 2
Query:    5 KMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGCISGSEKLVTQIR--NLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSY 691
            + G+    +D AD++ LEAA+      ++F ESP NP +   D+  V+ +  K GA V +D T+ TP  Q+ L LGADLV+HSATK++ GH D+ AG + GS+ LV +IR   L  + G  L+P+ A L++RG+KTL+LR+ +  + A  +A+ L   P+V+ +HYPGL S P++ +A QQM+  GG+++FE+ G + A  +F++AL++   A S G  ES+   PA M++
Sbjct:  127 EFGVKLRHVDMADLQALEAAMTPATRVIYF-ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGIVVGSQALVDRIRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLASFPQYTLARQQMSQPGGMIAFELKGGIGAGRRFMNALQLFSRAVSLGDAESLAQHPASMTH 356          
The following BLAST results are available for this feature:
BLAST of FC931320 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
METB_ARATH1.247e-11383.26Cystathionine gamma-synthase, chloroplastic OS=Ara... [more]
METC_LACLM1.189e-4740.87Cystathionine beta-lyase OS=Lactococcus lactis sub... [more]
METC_LACLA1.189e-4740.87Cystathionine beta-lyase OS=Lactococcus lactis sub... [more]
METB_HELPY1.189e-4740.87Cystathionine gamma-synthase OS=Helicobacter pylor... [more]
METC_LACLC1.315e-4640.87Cystathionine beta-lyase OS=Lactococcus lactis sub... [more]
MCCB_BACSU4.996e-4638.82Cystathionine gamma-lyase OS=Bacillus subtilis GN=... [more]
CGL_DICDI8.523e-4638.74Cystathionine gamma-lyase OS=Dictyostelium discoid... [more]
METC_COXBU1.113e-4538.43Cystathionine beta-lyase OS=Coxiella burnetii GN=m... [more]
METB_HELPJ4.230e-4539.13Cystathionine gamma-synthase OS=Helicobacter pylor... [more]
MEGL_PSEPU9.423e-4540.69Methionine gamma-lyase OS=Pseudomonas putida GN=md... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103H03EF PostHarvP1 Citrus clementina cDNA clone C34103H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931320 ID=FC931320|Name=FC931320|organism=Citrus clementina|type=EST|length=725bp
GCCCAAAATGGGAATCACGGCTACGGTGATTGACCCAGCTGATATGGAAG
GTTTGGAGGCAGCACTCAACAATAACAATGTCTCACTATTCTTCACCGAG
TCTCCAACCAATCCATTCCTGAGATGTGTGGATGTCAAACTGGTTTCAGA
TCTTTGCCATAAGAAAGGAGCAATAGTTTGCATAGATGGAACCTTTGCCA
CACCTCTCAATCAGAAGGCCCTCAGCCTTGGTGCTGATCTTGTACTGCAC
TCTGCAACAAAATTCATTGGTGGCCACAATGATGTCCTTGCTGGGTGCAT
TAGTGGTTCAGAGAAGTTAGTTACACAAATTCGTAATTTGCATCATGTTT
TGGGTGGTGCTCTCAACCCGAATGCCGCGTATTTGATCATTCGAGGCATG
AAGACATTGCATCTTCGTGTACAGCAACAAAATTCAACTGCGTTGAGGAT
GGCCAAGATTTTAGAGGCACATCCAAAGGTGAAGCGCGTTCACTATCCAG
GCTTGAAGAGTCATCCTGAGCATCACATTGCCACACAGCAAATGACTGGT
TTTGGTGGGGTAGTTAGTTTTGAGGTTGATGGAGACCTAACGGCCACCAT
AAAATTTATTGATGCCTTGAAAATCCCATATATTGCTCCATCCTTCGGTG
GCTGTGAGAGCATTGTTGATCAGCCAGCTATAATGTCGTATTGGGACCTT
AGCCATCGGAGAAGCTCAGTATGGG
back to top