FC931330

Overview
NameFC931330
Unique NameFC931330
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15157 contig Ccv1_Contig15157:240..947. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_ARATH (Proline iminopeptidase OS=Arabidopsis thaliana GN=PIP PE=2 SV=3)

HSP 1 Score: 335.495 bits (859), Expect = 1.691e-91
Identity = 161/221 (72.85%), Postives = 182/221 (82.35%), Query Frame = 2
Query:   47 LRFLPSSHQNFTLA--GRKDLVIRAQNFGVKSEPKLIDMMESGKELPELNTN-LYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHACLDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYEGGAAAIYPDAWESFRDLIPRNER 700
            +RF PS+H N  L   G++ + +     G KSE    D ME  +    +N   LY  +EPYS+G LKVSD+HT+YWEQSG P GHPVVFLHGGPGGGT PSNRRFFDP+FYRI+LFDQRGAGKSTPHACL++NTTWDL++DIEKLR+HL+IPEW VFGGSWGSTLALAYS +HPDKVTGLVLRGIFLLRKKEIDWFYEGGAAAIYPDAWE FRDLIP NER
Sbjct:   16 VRFFPSNHNNLNLLFPGQRKIQVSC---GGKSEVLKSDTMEPHEAETFVNKRTLYAPIEPYSSGNLKVSDVHTLYWEQSGKPDGHPVVFLHGGPGGGTAPSNRRFFDPEFYRIVLFDQRGAGKSTPHACLEENTTWDLVNDIEKLREHLKIPEWLVFGGSWGSTLALAYSQSHPDKVTGLVLRGIFLLRKKEIDWFYEGGAAAIYPDAWEEFRDLIPENER 233          
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_PLEBO (Probable proline iminopeptidase OS=Plectonema boryanum GN=pip PE=3 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.223e-67
Identity = 117/168 (69.64%), Postives = 137/168 (81.55%), Query Frame = 2
Query:  197 LYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHACLDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYEGGAAAIYPDAWESFRDLIPRNER 700
            LYP + PY +G+L VS +HTIY+EQSGNP G PVVFLHGGPGGGT P+ R++FDP  +RIILFDQRGAGKSTPHA L +NTTWDL+ DIEKLR HL I  W VFGGSWGSTL+LAYS  HPD+  GL+LRGIFLLR+KEI WFY+ GA+ I+PDAWE + + IP  ER
Sbjct:    4 LYPAIAPYQSGMLPVSALHTIYYEQSGNPNGKPVVFLHGGPGGGTIPTYRQYFDPSKWRIILFDQRGAGKSTPHAELRENTTWDLVSDIEKLRSHLNIDRWFVFGGSWGSTLSLAYSQTHPDRCLGLILRGIFLLRRKEILWFYQDGASWIFPDAWEHYLEPIPPEER 171          
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_XYLFA (Proline iminopeptidase OS=Xylella fastidiosa GN=pip PE=3 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.706e-59
Identity = 107/168 (63.69%), Postives = 127/168 (75.60%), Query Frame = 2
Query:  197 LYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHACLDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYEGGAAAIYPDAWESFRDLIPRNER 700
            LYP V P+  GIL V D H +Y+EQ GNP G PVV LHGGPG G     RRF DPD YRI+LFDQRGAG+STPHA L  NTTWDL+ DIEKLR  L I  WQVFGGSWGSTLALAY+  HP++ T LVLRGIF+LR+ E++WFY+ GA+ ++PDAW+ +  +IP  ER
Sbjct:    4 LYPEVTPFEHGILCVDDNHRLYYEQCGNPHGKPVVILHGGPGSGCNDKMRRFHDPDKYRIVLFDQRGAGRSTPHANLTNNTTWDLVADIEKLRVALGITRWQVFGGSWGSTLALAYAQTHPEQTTELVLRGIFMLRRWELEWFYQEGASHLFPDAWDRYIAVIPPVER 171          
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_XYLFT (Proline iminopeptidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pip PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.801e-59
Identity = 106/168 (63.10%), Postives = 126/168 (75.00%), Query Frame = 2
Query:  197 LYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHACLDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYEGGAAAIYPDAWESFRDLIPRNER 700
            LYP V P+  G+L V D H +Y+EQ GNP G PVV LHGGPGGG     RRF DPD YRI+LFDQRGAG+S PHA L  NTTWDL+ DIEKLR  L I  WQVFGGSWGSTLALAY+  HP++ T LVLRGIF+LR+ E++WFY+ GA+ ++PDAW+ +   IP  ER
Sbjct:    4 LYPEVTPFDHGMLCVDDSHRLYYEQCGNPHGKPVVILHGGPGGGCNDKMRRFHDPDKYRIVLFDQRGAGRSMPHANLTNNTTWDLVADIEKLRVALGITRWQVFGGSWGSTLALAYAQTHPEQTTELVLRGIFMLRRWELEWFYQEGASRLFPDAWDRYIAAIPPVER 171          
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_XANCI (Proline iminopeptidase OS=Xanthomonas campestris pv. citri GN=pip PE=1 SV=2)

HSP 1 Score: 223.402 bits (568), Expect = 9.363e-58
Identity = 105/169 (62.13%), Postives = 125/169 (73.96%), Query Frame = 2
Query:  197 LYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHACLDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYEGGAAAIYPDAWESFRDLIPRNERS 703
            LYP + PY  G LKV D HT+Y+EQ GNP G PVV LHGGPGGG     RRF DP  YRI+LFDQRG+G+STPHA L  NTTWDL+ DIE+LR HL +  WQVFGGSWGSTLALAY+         LVLRGIFLLR+ E++WFY+ GA+ ++PDAWE + + IP  ER+
Sbjct:    4 LYPEITPYQQGSLKVDDRHTLYFEQCGNPHGKPVVMLHGGPGGGCNDKMRRFHDPAKYRIVLFDQRGSGRSTPHADLVDNTTWDLVADIERLRTHLGVDRWQVFGGSWGSTLALAYAADPSAAGHQLVLRGIFLLRRFELEWFYQEGASRLFPDAWEHYLNAIPPVERA 172          
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_NEIMB (Proline iminopeptidase OS=Neisseria meningitidis serogroup B GN=pip PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.952e-55
Identity = 97/170 (57.06%), Postives = 125/170 (73.53%), Query Frame = 2
Query:  197 LYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHACLDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYE-GGAAAIYPDAWESFRDLIPRNERS 703
            +Y   +P+ +G L+VS+IH IYWE+SGNP G PV+FLHGGPG G +P  R FF+PD +RI++ DQRG G+S P+AC + NTTWDL+ DIEK+R+ L I +W VFGGSWGSTL+LAY+  HP++V GLVLRGIFL R  E  W  E GG + IYP+ W+ F   I  N R+
Sbjct:    1 MYEIKQPFHSGYLQVSEIHQIYWEESGNPDGVPVIFLHGGPGAGASPECRGFFNPDVFRIVIIDQRGCGRSRPYACAEDNTTWDLVADIEKVREMLGIGKWLVFGGSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETVWLNEAGGVSRIYPEQWQKFVAPIAENRRN 170          
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_NEIMA (Proline iminopeptidase OS=Neisseria meningitidis serogroup A GN=pip PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.952e-55
Identity = 97/170 (57.06%), Postives = 125/170 (73.53%), Query Frame = 2
Query:  197 LYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHACLDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYE-GGAAAIYPDAWESFRDLIPRNERS 703
            +Y   +P+ +G L+VS+IH IYWE+SGNP G PV+FLHGGPG G +P  R FF+PD +RI++ DQRG G+S P+AC + NTTWDL+ DIEK+R+ L I +W VFGGSWGSTL+LAY+  HP++V GLVLRGIFL R  E  W  E GG + IYP+ W+ F   I  N R+
Sbjct:    1 MYEIKQPFHSGYLQVSEIHQIYWEESGNPDGVPVIFLHGGPGAGASPECRGFFNPDVFRIVIIDQRGCGRSRPYACAEDNTTWDLVADIEKVREMLGIGKWLVFGGSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETVWLNEAGGVSRIYPEQWQKFVAPIAENRRN 170          
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_NEIGO (Proline iminopeptidase OS=Neisseria gonorrhoeae GN=pip PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.952e-55
Identity = 97/170 (57.06%), Postives = 125/170 (73.53%), Query Frame = 2
Query:  197 LYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHACLDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYE-GGAAAIYPDAWESFRDLIPRNERS 703
            +Y   +P+ +G L+VS+IH IYWE+SGNP G PV+FLHGGPG G +P  R FF+PD +RI++ DQRG G+S P+AC + NTTWDL+ DIEK+R+ L I +W VFGGSWGSTL+LAY+  HP++V GLVLRGIFL R  E  W  E GG + IYP+ W+ F   I  N R+
Sbjct:    1 MYEIKQPFHSGYLQVSEIHQIYWEESGNPDGVPVIFLHGGPGAGASPECRGFFNPDVFRIVIIDQRGCGRSHPYACAEDNTTWDLVADIEKVREMLGIGKWLVFGGSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETAWLNEAGGVSRIYPEQWQKFVAPIAENRRN 170          
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_SERMA (Proline iminopeptidase OS=Serratia marcescens GN=pip PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.330e-55
Identity = 92/168 (54.76%), Postives = 123/168 (73.21%), Query Frame = 2
Query:  197 LYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHACLDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYEGGAAAIYPDAWESFRDLIPRNER 700
            LYP +  Y +G L   D H IYWE SGNP G P VF+HGGPGGG +P +R+ FDP+ Y+++LFDQRG G+S PHA LD NTTW L+ DIE+LR+   + +W VFGGSWGSTLALAY+  HP++V+ +VLRGIF LRK+ + W+Y+ GA+  +P+ WE    ++  +ER
Sbjct:    7 LYPPLAAYDSGWLDTGDGHRIYWELSGNPNGKPAVFIHGGPGGGISPHHRQLFDPERYKVLLFDQRGCGRSRPHASLDNNTTWHLVADIERLREMAGVEQWLVFGGSWGSTLALAYAQTHPERVSEMVLRGIFTLRKQRLHWYYQDGASRFFPEKWERVLSILSDDER 174          
BLAST of FC931330 vs. ExPASy Swiss-Prot
Match: PIP_STRCO (Probable proline iminopeptidase OS=Streptomyces coelicolor GN=SCO1989 PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.131e-37
Identity = 82/174 (47.13%), Postives = 103/174 (59.20%), Query Frame = 2
Query:  194 NLYPYVEPYSTGILKVSDIHTIYWEQSGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKSTPHAC-----LDQNTTWDLIDDIEKLRQHLEIPEWQVFGGSWGSTLALAYSLAHPDKVTGLVLRGIFLLRKKEIDWFYEGGAAAIYPDAWESFRDLIPRNER 700
            +LYP +EPY  G+L V D + +YWE  GNP G P V LHGGPG   +P  RR+FDP  YRI+L DQRGAG+S P A      +  NTT  L+ D+E+LR HL I  W V+G SWGS L L Y+  HP  VT LVL G+      E+      G   I+P+A E F   +P + R
Sbjct:    2 SLYPEIEPYDHGMLDVGDGNHVYWETCGNPHGKPAVVLHGGPGSRASPGLRRYFDPAAYRIVLLDQRGAGRSLPRASAPDTDMSVNTTAHLMADLERLRVHLGIERWLVWGVSWGSVLGLRYAQTHPGVVTELVLTGVATGSNAEVA-LLTRGLGNIFPEAHERFLAELPPDAR 174          
The following BLAST results are available for this feature:
BLAST of FC931330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
PIP_ARATH1.691e-9172.85Proline iminopeptidase OS=Arabidopsis thaliana GN=... [more]
PIP_PLEBO2.223e-6769.64Probable proline iminopeptidase OS=Plectonema bory... [more]
PIP_XYLFA1.706e-5963.69Proline iminopeptidase OS=Xylella fastidiosa GN=pi... [more]
PIP_XYLFT3.801e-5963.10Proline iminopeptidase OS=Xylella fastidiosa (stra... [more]
PIP_XANCI9.363e-5862.13Proline iminopeptidase OS=Xanthomonas campestris p... [more]
PIP_NEIMB1.952e-5557.06Proline iminopeptidase OS=Neisseria meningitidis s... [more]
PIP_NEIMA1.952e-5557.06Proline iminopeptidase OS=Neisseria meningitidis s... [more]
PIP_NEIGO1.952e-5557.06Proline iminopeptidase OS=Neisseria gonorrhoeae GN... [more]
PIP_SERMA3.330e-5554.76Proline iminopeptidase OS=Serratia marcescens GN=p... [more]
PIP_STRCO3.131e-3747.13Probable proline iminopeptidase OS=Streptomyces co... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104A01EF PostHarvP1 Citrus clementina cDNA clone C34104A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931330 ID=FC931330|Name=FC931330|organism=Citrus clementina|type=EST|length=708bp
GACTTCACGTACTTCCTCGCTTCCTCACACCTCCACTTTATCTCGTCTCA
GGTTCCTCCCTTCATCCCATCAGAATTTCACTCTCGCAGGGAGGAAGGAT
TTAGTAATACGTGCACAAAATTTTGGGGTTAAGAGTGAGCCAAAGCTCAT
TGATATGATGGAATCAGGAAAGGAATTACCAGAATTGAATACGAATCTTT
ATCCTTATGTAGAGCCATACAGTACAGGCATTTTGAAGGTTTCTGATATT
CACACAATCTACTGGGAGCAGTCTGGAAACCCTACCGGGCATCCTGTTGT
GTTTCTTCATGGAGGTCCAGGAGGAGGCACTACACCAAGTAATCGAAGAT
TCTTTGATCCCGATTTTTACCGTATCATTTTATTTGATCAGCGAGGTGCA
GGAAAAAGTACCCCTCATGCTTGCTTGGATCAAAACACCACATGGGATCT
CATTGATGACATTGAAAAGTTGAGACAACACCTAGAAATTCCAGAATGGC
AGGTATTTGGTGGATCATGGGGAAGCACACTTGCTCTTGCATACAGCCTG
GCACACCCCGACAAGGTTACTGGCTTGGTCCTCAGGGGGATCTTTCTTTT
GCGAAAGAAAGAGATTGATTGGTTTTATGAGGGTGGTGCTGCTGCTATAT
ACCCTGATGCATGGGAGTCATTCAGAGACCTCATTCCNAGAAATGAAAGA
AGTGTTTT
back to top