FC931386

Overview
NameFC931386
Unique NameFC931386
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length690
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9598 contig Ccv1_Contig9598:5..694. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GSTF_HYOMU (Glutathione S-transferase OS=Hyoscyamus muticus PE=1 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.485e-70
Identity = 130/207 (62.80%), Postives = 157/207 (75.85%), Query Frame = 2
Query:   65 GIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 682
            G+K+HG   S A  RV A+L EK+L++ELVPV+M+AG+HKKE  ++LNPFGQVP  E GD KLFESRAITQYIA  + DKG QL     K +A + VW EVE+ +FDP +SKL +E+V KPM GM TD AAV ENE KL K+LDVYE+RL  SKYL  DSFTL DLHH P +N L+GT VK LFD+RPHVSAW ADI +RPAW+K +
Sbjct:    2 GMKLHGPAMSPAVMRVIATLKEKDLDFELVPVNMQAGDHKKEPFITLNPFGQVPAFEDGDLKLFESRAITQYIAHTYADKGNQLLANDPKKMAIMSVWMEVESQKFDPVASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPAMNYLMGTKVKSLFDSRPHVSAWCADILARPAWSKAI 208          
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GSTF6_ARATH (Glutathione S-transferase 6, chloroplastic OS=Arabidopsis thaliana GN=GST6 PE=1 SV=3)

HSP 1 Score: 263.462 bits (672), Expect = 7.763e-70
Identity = 135/212 (63.68%), Postives = 164/212 (77.36%), Query Frame = 2
Query:   59 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG--KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLAL 688
            MA IKVHG   STAT RV A+LYEK+L++EL+PVDM+AG HK+EA L+LNPFGQ+P LE GD  LFESRAITQY+A+E+ +KG +L      K  A   VW +VE  QFDP +SKL +E V+K MFGMTTDPAAV+E E KL K+LDVYEARL++S++LA DSFTL DLHHLP I+ LLGT  K LFD+RP VS W   I++RPAWAKV+ L
Sbjct:   49 MASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDSRPKVSEWIKKISARPAWAKVIDL 260          
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GSTF1_TOBAC (Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 2.950e-69
Identity = 130/206 (63.11%), Postives = 157/206 (76.21%), Query Frame = 2
Query:   68 IKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 682
            IKVHGS  STAT RV A L EKEL++E VPVDM +GEHKK   LSLNPFGQVP  E GD KLFESRAITQYIA  + D G QL     K +  + VW EVE  +F+PP++KL WEL  KP+ GMTTD AAV+E+EA+L+K+LD+YE +L++SKYL  DSFTLVDLHH+PNI  L+ + VK++FD+RP VSAW ADI +RPAW K L
Sbjct:    3 IKVHGSPMSTATMRVAACLIEKELDFEFVPVDMASGEHKKHPYLSLNPFGQVPAFEDGDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPSMSVWMEVEGQKFEPPATKLTWELGIKPIIGMTTDDAAVKESEAQLSKVLDIYETQLAESKYLGGDSFTLVDLHHIPNIYYLMSSKVKEVFDSRPRVSAWCADILARPAWVKGL 208          
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GSTF1_ARATH (Glutathione S-transferase 1 OS=Arabidopsis thaliana GN=GST1 PE=1 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 6.572e-69
Identity = 132/208 (63.46%), Postives = 155/208 (74.52%), Query Frame = 2
Query:   59 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 682
            MAGIKV G   STAT+RV  +L+EK +++E V V++K GEHKKE  +  NPFG+VP  E GD K+FESRAITQYIA EF DKG  L   GK +A + +  E+E+ +FDP  SKL WE V KP++GMTTD   VEE EAKLAK+LDVYE RL +SKYLA D FTLVDLH +P I  LLGTP KKLFD RPHVSAW ADITSRP+  KVL
Sbjct:    1 MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAQKVL 208          
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GSTF2_TOBAC (Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.464e-68
Identity = 130/206 (63.11%), Postives = 155/206 (75.24%), Query Frame = 2
Query:   68 IKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLL-VWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 682
            IKVHGS  STAT RV A L EK+L++ELVPVDM +GEHKK   LSLNPFGQVP  E GD KLFESRAITQYIA  + D G QL        P++ VW EVE  +F+P +SKL WEL  KP+ GMTTD  AV+E+E +L+K+LD+YE RL++SKYL  DSFTLVDLHH+PNI  L+ T VK++FD+RP VSAW ADI +RPAW K L
Sbjct:    3 IKVHGSPMSTATMRVAACLIEKDLDFELVPVDMVSGEHKKHPYLSLNPFGQVPAFEDGDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPIMSVWMEVEGQKFEPHASKLTWELGIKPIIGMTTDDDAVKESEVQLSKVLDIYETRLAESKYLGGDSFTLVDLHHIPNIYYLMSTKVKEVFDSRPRVSAWCADILARPAWVKGL 208          
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GST11_ARATH (Glutathione S-transferase 11 OS=Arabidopsis thaliana GN=GST11 PE=1 SV=3)

HSP 1 Score: 256.529 bits (654), Expect = 9.490e-68
Identity = 133/209 (63.64%), Postives = 155/209 (74.16%), Query Frame = 2
Query:   59 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 682
            MAGIKV G   STAT+RV  +L+EK L++E V +++K GEHKKE  +  NPFG+VP  E GD KLFESRAITQYIA  + DKG QL   G K IA + +  E+E+ +FDP  SKL WE V KP++GMTTD   VEE EAKLAK+LDVYE RL +SKYLA D FTLVDLH +P I  LLGTP KKLFD RPHVSAW ADITSRP+  KVL
Sbjct:    1 MAGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAKKVL 209          
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GSTF_SILCU (Glutathione S-transferase OS=Silene cucubalus GN=GST PE=1 SV=3)

HSP 1 Score: 256.144 bits (653), Expect = 1.239e-67
Identity = 135/211 (63.98%), Postives = 162/211 (76.78%), Query Frame = 2
Query:   68 IKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIA--QEFPDKGTQLTCPGK-PIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYL-ACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLAL 688
            IKVHG+  STATQRV  +LYEK LE+E VP+DM AG HK+ + L+LNPFGQVP LE G+ KLFESRAIT+Y+A   +  ++GT L    K  +A  LVW+EVEA QFDP +SKL WELV+K +FGM TD   VEENEAKLAK+LDVYEARL++S+YL A DSFTLVDLHHLP +  L+GT VKKLF+ R HVSAW   I +RP+W K LAL
Sbjct:    3 IKVHGNPRSTATQRVLVALYEKHLEFEFVPIDMGAGGHKQPSYLALNPFGQVPALEDGEIKLFESRAITKYLAYTHDHQNEGTSLIHKEKHEMAAQLVWEEVEAHQFDPVASKLAWELVFKGIFGMQTDTTVVEENEAKLAKVLDVYEARLTESEYLGANDSFTLVDLHHLPLLGYLMGTQVKKLFEERAHVSAWCKKILARPSWEKTLAL 213          
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GST16_ARATH (Glutathione S-transferase 16 OS=Arabidopsis thaliana GN=GST16 PE=1 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.493e-62
Identity = 127/212 (59.91%), Postives = 151/212 (71.23%), Query Frame = 2
Query:   59 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLT-CPGKPIAPLLVWK---EVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 682
            MAGIKV G   ST+T+RV  +L+EK L++ELV V++K GEHKKE  LS NPFGQVP  E GD KLFESRAITQYIA  + ++GT L     K IA   +     +VEA QFDP +SKL WE V+K  +G+ TD A V E EAKLAK+LDVYEARL + KYLA ++FTL DLHH+P I  LLGTP KKLF  RP V+ W A+IT RPA  KVL
Sbjct:    1 MAGIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVL 212          
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GSTF4_ARATH (Glutathione S-transferase PM24 OS=Arabidopsis thaliana GN=PM24.1 PE=1 SV=3)

HSP 1 Score: 232.646 bits (592), Expect = 1.467e-60
Identity = 124/211 (58.77%), Postives = 151/211 (71.56%), Query Frame = 2
Query:   59 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLT-CPGKPI---APLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKV 679
            MAGIKV G   S AT+RV  +L+EK L++ELV V++K GEHKKE  LS NPFGQVP  E GD KLFESRAITQYIA  + ++GT L     K I   A + +  +VE  QFDP +SKL +E ++K ++G+TTD A V E EAKLAK+LDVYEARL + KYLA ++FTL DLHH+P I  LLGTP KKLF  RP V+ W A+IT RPA  KV
Sbjct:    1 MAGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKV 211          
BLAST of FC931386 vs. ExPASy Swiss-Prot
Match: GSTF3_MAIZE (Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE=1 SV=4)

HSP 1 Score: 174.481 bits (441), Expect = 4.742e-43
Identity = 96/210 (45.71%), Postives = 130/210 (61.90%), Query Frame = 2
Query:   59 MAGIKVHGSVFSTATQRVFASLYEKELEYELVPVDMKAGEHKKEALLSLNPFGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLSQSKYLACDSFTLVDLHHLPNINLLLGTPVKK-LFDARPHVSAWAADITSRPAWAKVLA 685
            MA +K++G   S    RV   L EK L++E+VPVD+  G HK+   L+LNPFGQ+P L  GD+ LFESRAI +YIA ++  +GT L       A L VW EVE+  F P +S L ++L+ +P+ G   D A VE++  +LAK+LDVYEA L+++KYLA D FTL D +H     L    P +     ARPHV AW   I +RPA+ K +A
Sbjct:    1 MAPLKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLALNPFGQIPALVDGDEVLFESRAINRYIASKYASEGTDLLPATASAAKLEVWLEVESHHFHPNASPLVFQLLVRPLLGGAPDAAVVEKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHALLPALTSARPPRPGCVAARPHVKAWWEAIAARPAFQKTVA 210          
The following BLAST results are available for this feature:
BLAST of FC931386 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
GSTF_HYOMU3.485e-7062.80Glutathione S-transferase OS=Hyoscyamus muticus PE... [more]
GSTF6_ARATH7.763e-7063.68Glutathione S-transferase 6, chloroplastic OS=Arab... [more]
GSTF1_TOBAC2.950e-6963.11Glutathione S-transferase PARB OS=Nicotiana tabacu... [more]
GSTF1_ARATH6.572e-6963.46Glutathione S-transferase 1 OS=Arabidopsis thalian... [more]
GSTF2_TOBAC1.464e-6863.11Glutathione S-transferase APIC OS=Nicotiana tabacu... [more]
GST11_ARATH9.490e-6863.64Glutathione S-transferase 11 OS=Arabidopsis thalia... [more]
GSTF_SILCU1.239e-6763.98Glutathione S-transferase OS=Silene cucubalus GN=G... [more]
GST16_ARATH3.493e-6259.91Glutathione S-transferase 16 OS=Arabidopsis thalia... [more]
GSTF4_ARATH1.467e-6058.77Glutathione S-transferase PM24 OS=Arabidopsis thal... [more]
GSTF3_MAIZE4.742e-4345.71Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34104E11EF PostHarvP1 Citrus clementina cDNA clone C34104E11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931386 ID=FC931386|Name=FC931386|organism=Citrus clementina|type=EST|length=690bp
ACCTCTCACAAGTCAAGTCACAACTCACAATAACAAGCGAGGGAAGGAAG
ACCCAAAGATGGCAGGCATCAAGGTCCACGGTTCTGTTTTCTCAACTGCT
ACGCAGCGAGTTTTCGCATCCCTCTACGAGAAGGAGCTCGAATACGAGCT
TGTCCCCGTAGACATGAAGGCTGGTGAACACAAAAAGGAGGCCCTCCTTT
CTTTGAATCCATTCGGTCAAGTTCCGGTGCTTGAACACGGCGACCAGAAG
CTCTTCGAATCAAGGGCAATCACCCAATACATCGCCCAGGAGTTTCCAGA
CAAAGGCACCCAGTTAACATGCCCAGGCAAGCCCATCGCCCCGTTATTGG
TATGGAAGGAGGTGGAGGCACTCCAGTTCGACCCCCCATCATCGAAGCTC
AACTGGGAGCTCGTGTACAAGCCAATGTTTGGAATGACCACTGATCCAGC
TGCGGTTGAAGAAAATGAAGCTAAGCTTGCCAAAATTTTAGATGTTTACG
AGGCCCGTTTGTCTCAGTCCAAATACTTGGCGTGCGACAGCTTCACCTTG
GTCGATTTGCATCATCTCCCCAATATTAATTTGTTGTTGGGGACGCCTGT
CAAGAAGCTGTTTGATGCACGCCCCCATGTTAGCGCATGGGCAGCTGATA
TCACTTCCAGACCGGCTTGGGCTAAGGTCCTTGCCTTGCT
back to top