FC931394

Overview
NameFC931394
Unique NameFC931394
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length729
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14439 contig Ccv1_Contig14439:41..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. japonica GN=SAP8 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.838e-62
Identity = 116/173 (67.05%), Postives = 135/173 (78.03%), Query Frame = 2
Query:  173 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            M+H ETGCQ P EGPILCINNCGFFGS ATMNMCSKC+K++++KQ+QAKLAASSI SIVN     +G E + A   +V  + VE K +  QP+  +  SE V   PK  EGP+RCS+C+KRVGLTGF CRCGNLYC  HRYSDKH+C FDYRTAARDAI KANPV+KAEKLDK
Sbjct:    1 MEHKETGCQQP-EGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVN--GGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDK 170          
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSI (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. indica GN=SAP8 PE=2 SV=2)

HSP 1 Score: 238.039 bits (606), Expect = 3.838e-62
Identity = 116/173 (67.05%), Postives = 135/173 (78.03%), Query Frame = 2
Query:  173 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            M+H ETGCQ P EGPILCINNCGFFGS ATMNMCSKC+K++++KQ+QAKLAASSI SIVN     +G E + A   +V  + VE K +  QP+  +  SE V   PK  EGP+RCS+C+KRVGLTGF CRCGNLYC  HRYSDKH+C FDYRTAARDAI KANPV+KAEKLDK
Sbjct:    1 MEHKETGCQQP-EGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVN--GGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDK 170          
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP4_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Oryza sativa subsp. japonica GN=SAP4 PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 6.127e-60
Identity = 111/173 (64.16%), Postives = 131/173 (75.72%), Query Frame = 2
Query:  173 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            M+H E GCQ P EGPILCINNCGFFGS ATMNMCSKC+K++++K++QAKLAASSI SIVN           A+ +  V  + VE K + VQP+  +  SE V   PK  EGP+RC++C+KRVGLTGF CRCGN+YC  HRYSDKH C FDYRTAARDAI KANPV+KAEKLDK
Sbjct:    1 MEHKEAGCQQP-EGPILCINNCGFFGSAATMNMCSKCHKEMIMKEEQAKLAASSIDSIVNGCDGGKEHIVAASGSTAVAVAQVEAKTLVVQPTDVAGTSEEVAVVPKVKEGPNRCATCRKRVGLTGFNCRCGNMYCALHRYSDKHECQFDYRTAARDAIAKANPVVKAEKLDK 172          
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP2_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 2 OS=Arabidopsis thaliana GN=SAP2 PE=2 SV=2)

HSP 1 Score: 220.32 bits (560), Expect = 8.281e-57
Identity = 107/177 (60.45%), Postives = 134/177 (75.71%), Query Frame = 2
Query:  173 MDHDETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNG--SESVAAATVDVQASSVEPKIISVQPSCASELSESVE----AKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            MDHD+TGCQ+PPEGP LC NNCGFFGS ATMNMCSKC+KD++ +Q+Q    AS++      TSSS+    E+  AA VD++  SVEP  +SVQPS    ++E V     AKPK GPSRC++C KRVGLTGFKCRCG+L+C +HRY+D H+C F+Y  AA++AI KANPV+KAEKLDK
Sbjct:    1 MDHDKTGCQSPPEGPKLCTNNCGFFGSAATMNMCSKCHKDMLFQQEQGAKFASAVSG----TSSSSNIIKETFTAALVDIETKSVEPMTVSVQPSSVQVVAEVVAPEEAAKPK-GPSRCTTCNKRVGLTGFKCRCGSLFCGTHRYADVHDCSFNYHAAAQEAIAKANPVVKAEKLDK 172          
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP6_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Arabidopsis thaliana GN=SAP6 PE=2 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 1.164e-34
Identity = 79/176 (44.89%), Postives = 111/176 (63.07%), Query Frame = 2
Query:  182 DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSE--------SVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            +E  CQ P E   LC+NNCGF GS ATMN+CS CY D+ LKQ Q    +SSI S V E+S S    S +++ +   +S + P ++   PS   E+ E        + E   ++ P+RC++C+KRVGLTGFKCRCG ++C  HRY + H C +D+++A R+ I KANP++KA KL K
Sbjct:    3 EEHRCQTP-ESNRLCVNNCGFLGSSATMNLCSNCYGDLCLKQQQQ---SSSIKSTV-ESSLSVSPPSSSSSEI---SSPIIPPLLK-NPSVKLEVPEKKAVISLPTTEQNQQQRPNRCTTCRKRVGLTGFKCRCGTMFCGVHRYPEIHGCSYDFKSAGREEIAKANPLVKAAKLQK 169          
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP7_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 7 OS=Arabidopsis thaliana GN=SAP7 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.422e-34
Identity = 65/164 (39.63%), Postives = 106/164 (64.63%), Query Frame = 2
Query:  203 PPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSC---ASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            PP  P LC N CGFFGS + MN+CSKCY+ +  ++DQ  +A +++ + +   S S  +       ++++ + +E  +++ +PS    A+E  E+  ++P    +RC SC K+VG+ GFKC+CG+ +C SHRY +KH C FD++   RDAI KANP++KA+K+ +
Sbjct:   12 PPTEPKLCDNGCGFFGSPSNMNLCSKCYRSLRAEEDQTAVAKAAVKNSLKLPSCSIIAPG-QKHPLEIKPAHLETVVVTAEPSSVPVAAEQDEAEPSRPVRPNNRCFSCNKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKANPLVKADKVQR 174          
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP9_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Oryza sativa subsp. japonica GN=SAP9 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.775e-34
Identity = 72/160 (45.00%), Postives = 98/160 (61.25%), Query Frame = 2
Query:  206 PEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            PE PILC+NNCGFFGS  T NMCSKCY+D +       +AA  +       +SS+ +    A   +V A++VE K  + +P             PK   +RC SC+K+VGLTGF+CRCG  +C +HRY++ H+C FDY+ A RD I K NPV+ AEK++K
Sbjct:   17 PEAPILCVNNCGFFGSSMTNNMCSKCYRDFV---KVTTMAAPVVEKKAFTPASSSKTPLEPAKPDEVPAAAVEDKQAAQEP-------------PKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHRYTEAHDCTFDYKKAGRDQIAKQNPVVIAEKINK 160          
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP4_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Arabidopsis thaliana GN=SAP4 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.542e-34
Identity = 71/168 (42.26%), Postives = 97/168 (57.74%), Query Frame = 2
Query:  182 DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            +E  C+ P EG  LC+NNCGFFGS ATMN+CS CY D+ LKQ Q     S++ S ++   +       A   +     + E K I +            +  P + P+RC+ C+KRVGLTGF CRCG  +C SHRY + H C FD+++A R+ I KANP++ A KL K
Sbjct:    3 EEHRCETP-EGHRLCVNNCGFFGSSATMNLCSNCYGDLCLKQQQQASMKSTVESSLSPVIAPVLENYAAELEIPTTKKTEEKKPIQIPTE---------QPSPPQRPNRCTVCRKRVGLTGFMCRCGTTFCGSHRYPEVHGCTFDFKSAGREEIAKANPLVIAAKLQK 160          
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP1_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Arabidopsis thaliana GN=SAP1 PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 6.385e-33
Identity = 66/160 (41.25%), Postives = 92/160 (57.50%), Query Frame = 2
Query:  206 PEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            P  P LC+  CGFFGS + MN+CSKCY+DI   ++Q   A +++   +N        +     T  V  S           S A+ L       PK   +RC SC K+VG+TGFKCRCG+ +C +HRY + H C FD++  AR+AI KANPV+KA+K+D+
Sbjct:   13 PSEPKLCVKGCGFFGSPSNMNLCSKCYRDIRATEEQTASAKAAVEKSLNPNKPKTQPQQSQEITQGVLGSGSSSSSTRGGDSAAAPLDP-----PKSTATRCLSCNKKVGVTGFKCRCGSTFCGTHRYPESHECQFDFKGVAREAIAKANPVVKADKVDR 167          
BLAST of FC931394 vs. ExPASy Swiss-Prot
Match: SAP6_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Oryza sativa subsp. japonica GN=SAP6 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.426e-32
Identity = 71/168 (42.26%), Postives = 94/168 (55.95%), Query Frame = 2
Query:  182 DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDK 685
            +ETG   P E PILC+NNCGFFGS  T NMCSKCY+D +         A ++ ++V +   ++ S +     V    S           S A       E  PK   +RC SC+K+VGLTGFKCRCG  +C  HRY+D H C FDY+   R+ I K NP++KA+K+ K
Sbjct:   11 EETGVHTP-EAPILCVNNCGFFGSRMTENMCSKCYRDTV--------KAKTVATVVEKKPLASLSSTPLVTEVTDGGSG----------SVADGKQVMEEDTPKPPSNRCLSCRKKVGLTGFKCRCGGTFCSMHRYADSHKCTFDYKQVGREQIAKQNPLVKADKITK 159          
The following BLAST results are available for this feature:
BLAST of FC931394 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
SAP8_ORYSJ3.838e-6267.05Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP8_ORYSI3.838e-6267.05Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP4_ORYSJ6.127e-6064.16Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP2_ARATH8.281e-5760.45Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP6_ARATH1.164e-3444.89Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP7_ARATH4.422e-3439.63Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP9_ORYSJ5.775e-3445.00Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP4_ARATH7.542e-3442.26Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP1_ARATH6.385e-3341.25Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP6_ORYSJ2.426e-3242.26Zinc finger A20 and AN1 domain-containing stress-a... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34104F07EF PostHarvP1 Citrus clementina cDNA clone C34104F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931394 ID=FC931394|Name=FC931394|organism=Citrus clementina|type=EST|length=729bp
GACCCGGAAAGGGAAACGAGGCACGTCTCTAATCGGTTTTTGCCTGCTCT
CTCCCCGTAGGCCGATCTGGTCCATTTAATTTTAGGGGCTCATTGGATGC
TGGCTTGAGCTCGGGGATCGGCTTAAGGGATTCATTGCTGTTTCTTCTGT
TGCTCGCAGGGGTGGTGAAAACATGGACCATGATGAGACTGGATGCCAAG
CTCCTCCTGAGGGCCCTATCTTGTGCATCAACAATTGTGGTTTCTTTGGA
AGTGTGGCTACTATGAATATGTGTTCCAAATGCTACAAGGATATAATGCT
GAAACAGGATCAAGCTAAGCTTGCTGCTTCATCTATTGGAAGCATTGTGA
ATGAAACGTCAAGCAGCAATGGAAGTGAATCTGTTGCTGCTGCCACTGTT
GATGTGCAAGCTAGTTCAGTGGAGCCAAAAATCATCTCTGTGCAGCCATC
ATGTGCTTCAGAATTGAGCGAGAGTGTGGAGGCAAAGCCGAAGGAGGGTC
CCAGCCGGTGCAGCAGTTGCAAGAAGCGTGTTGGTTTAACAGGATTCAAA
TGTCGCTGTGGTAACTTATACTGTGTGTCACATCGCTATTCGGACAAACA
TAACTGCCCCTTTGACTACCGCACTGCTGCTAGGGATGCTATAATTAAAG
CAAACCCTGTGATCAAGGCTGAGAAGCTAGATAAATCTAGATTCATGGGA
TGAGGTTTCAAATATCAAGATGATGATCT
back to top