FC931398

Overview
NameFC931398
Unique NameFC931398
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length712
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15122 contig Ccv1_Contig15122:55..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: MDAR_SOLLC (Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 2.373e-101
Identity = 185/230 (80.43%), Postives = 199/230 (86.52%), Query Frame = 3
Query:   21 MAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYYANKGNQIIKGTXAVG 710
            MAEKSFKYVI+GGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEG ARLPGFHVCVGSGGER LPEWY EKGI LILSTEIV+AD+ASKTL+SA G  FKYQ LVIATG+TVL+L+DFGV+GAD+KNIFYLREIDDAD+LVE                YIGLELSA L++NNI+V+MVYPEPWCMPRLFT  IAAFYEGYY NKG  IIKGT AVG
Sbjct:    1 MAEKSFKYVIVGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGAARLPGFHVCVGSGGERQLPEWYAEKGISLILSTEIVKADLASKTLVSAAGESFKYQTLVIATGTTVLKLSDFGVQGADSKNIFYLREIDDADQLVEALKAKKNGKAVVVGGGYIGLELSAVLRLNNIEVNMVYPEPWCMPRLFTEGIAAFYEGYYKNKGVNIIKGTVAVG 230          
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: MDAR3_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 3 OS=Arabidopsis thaliana GN=At3g52880 PE=1 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 2.901e-99
Identity = 179/230 (77.83%), Postives = 200/230 (86.96%), Query Frame = 3
Query:   21 MAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYYANKGNQIIKGTXAVG 710
            MAEKSFKY+ILGGGVSAGYAA+EFA QGV+PGELA+ISKEAVAPYERPALSK YLFPEG ARLPGFH CVGSGGE+LLPE YK+KGIELILSTEIV+AD+++K+L+SATG +FKYQ L+IATGSTVLRLTDFGV+GAD+KNI YLREIDDADKLVE                YIGLELSA L+INN+DV+MV+PEPWCMPRLFTADIAAFYE YY NKG +IIKGT A G
Sbjct:    1 MAEKSFKYIILGGGVSAGYAAKEFANQGVQPGELAVISKEAVAPYERPALSKGYLFPEGAARLPGFHCCVGSGGEKLLPESYKQKGIELILSTEIVKADLSAKSLVSATGDVFKYQTLIIATGSTVLRLTDFGVKGADSKNILYLREIDDADKLVEAIKAKKGGKAVVVGGGYIGLELSAVLRINNLDVTMVFPEPWCMPRLFTADIAAFYETYYTNKGVKIIKGTVASG 230          
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: MDARS_CUCSA (Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 4.188e-98
Identity = 178/230 (77.39%), Postives = 195/230 (84.78%), Query Frame = 3
Query:   21 MAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYYANKGNQIIKGTXAVG 710
            MA+++FKYVILGGGV+AGYAAREF KQG+ PGELAIISKEAVAPYERPALSKAYLFPE  ARLPGFHVCVGSGGERLLP+WYKEKGIELILSTEIV AD+ +K L SA G I+ YQ L+IATGSTV++L+DFGV+GADAKNIFYLREIDDAD+LVE                YIGLEL AAL+INN DVSMVYPEPWCMPRLFT +IAAFYEGYYA KG  IIKGT AVG
Sbjct:    1 MADETFKYVILGGGVAAGYAAREFVKQGLNPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLLPDWYKEKGIELILSTEIVEADLPAKRLRSAHGKIYNYQTLIIATGSTVIKLSDFGVQGADAKNIFYLREIDDADQLVEAIKAKENGKVVVVGGGYIGLELGAALRINNFDVSMVYPEPWCMPRLFTPEIAAFYEGYYAQKGITIIKGTVAVG 230          
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: MDAR_PEA (Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 5.661e-95
Identity = 174/226 (76.99%), Postives = 188/226 (83.19%), Query Frame = 3
Query:   33 SFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYYANKGNQIIKGTXAVG 710
            SFKY+I+GGGVSAGYAAREF KQGV PGELAIISKEAVAPYERPALSKAYLFPE  ARLPGFH CVGSGGERLLPEWY EKGI+L LSTEIV AD+A+K L SA G  F YQ LVIATGS V+RLTDFGV GA+AKNIFYLRE+DDADKL E                YIGLELSA LK+N++DV+MVYPEPWCMPRLFT++IAAFYEGYYANKG  IIKGT AVG
Sbjct:    4 SFKYIIIGGGVSAGYAAREFVKQGVHPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHTCVGSGGERLLPEWYSEKGIQLYLSTEIVSADLAAKFLKSANGEHFDYQTLVIATGSAVIRLTDFGVIGANAKNIFYLREVDDADKLYEAIKRKKNAKRVVVGGGYIGLELSAVLKLNDLDVTMVYPEPWCMPRLFTSEIAAFYEGYYANKGINIIKGTVAVG 229          
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: MDAR4_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 4 OS=Arabidopsis thaliana GN=At5g03630 PE=1 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 7.411e-87
Identity = 159/228 (69.74%), Postives = 180/228 (78.95%), Query Frame = 3
Query:   27 EKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYYANKGNQIIKGTXAVG 710
            EKSFKYVI+GGGV+AGYAAREF  QGVKPGELAIIS+E V PYERPALSK Y+  E  A LP F+V  G GGER  P+WYKEKGIELIL TEIV+AD+A+KTL+S TG +FKYQ L+ ATGS+V+RL+DFGV GADAKNIFYLRE++DAD L                  YIGLEL AALK NN+DV+MVYPEPWCMPRLFTA IA+FYEGYYANKG  I+KGT A G
Sbjct:    4 EKSFKYVIVGGGVAAGYAAREFFNQGVKPGELAIISREQVPPYERPALSKGYIHLENKATLPNFYVAAGIGGERQFPQWYKEKGIELILGTEIVKADLAAKTLVSGTGQVFKYQTLLAATGSSVIRLSDFGVPGADAKNIFYLRELEDADYLAYAMETKEKGKAVVVGGGYIGLELGAALKANNLDVTMVYPEPWCMPRLFTAGIASFYEGYYANKGINIVKGTVASG 231          
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: MDAR1_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 1 OS=Arabidopsis thaliana GN=At3g09940 PE=2 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.959e-71
Identity = 134/229 (58.52%), Postives = 172/229 (75.11%), Query Frame = 3
Query:   27 EKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKL-VEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYYANKGNQIIKGTXAVG 710
            EKS+KYVI+GGGV+ GYAAREF+ QG+KPGELAIISKE V P+ERP L+K Y+  E    L   +VC G+G  +  P WYKEKGI+LI+ TEIV+AD+ASKTL+S  G I+KYQ L+IATGST +RL++ GV+ AD KNIFYLREI+D+D+L +                 ++GLE+S+AL+ NN +V+MV+PEPW + R FTA+IA+FYE YYANKG +IIKGT A G
Sbjct:    4 EKSYKYVIIGGGVAGGYAAREFSNQGLKPGELAIISKEPVPPFERPELTKVYIDLEVNPTLANIYVCAGTGEAKQYPNWYKEKGIDLIVGTEIVKADLASKTLVSDDGKIYKYQTLLIATGSTNIRLSEIGVQEADVKNIFYLREIEDSDELALAMELYVQRGKAVIIGGGFLGLEISSALRANNHEVTMVFPEPWLVHRFFTAEIASFYESYYANKGIKIIKGTVATG 232          
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: MDAR2_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 2 OS=Arabidopsis thaliana GN=At3g27820 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.230e-65
Identity = 122/223 (54.71%), Postives = 157/223 (70.40%), Query Frame = 3
Query:   30 KSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYYANKGNQIIKGT 698
            ++F YVILGGGV+AGYAA EF ++GV  GEL IIS+E VAPYERPALSK +L PE  ARLP FH CVG+  E+L P+WYK+ GIEL+L T +   D+  KTLLS+TG    Y+ L+IATG+  L+L +FGVEG+DA+N+ YLR++ DA++L                  YIG+E +A+L IN I+V+MV+PE  CM RLFT  IA+ YE YY  KG + IKGT
Sbjct:    3 RAFVYVILGGGVAAGYAALEFTRRGVSDGELCIISEEPVAPYERPALSKGFLLPEAPARLPSFHTCVGANDEKLTPKWYKDHGIELVLGTRVKSVDVRRKTLLSSTGETISYKFLIIATGARALKLEEFGVEGSDAENVCYLRDLADANRLATVIQSSSNGNAVVIGGGYIGMECAASLVINKINVTMVFPEAHCMARLFTPKIASLYEDYYRAKGVKFIKGT 225          
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: MDARP_ARATH (Monodehydroascorbate reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g63940 PE=2 SV=3)

HSP 1 Score: 191.815 bits (486), Expect = 3.044e-48
Identity = 104/228 (45.61%), Postives = 137/228 (60.09%), Query Frame = 3
Query:   18 SMAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFP--EGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFTADIAAFYEGYYANKGNQIIKG 695
            S A ++ ++VI+GGG +AGYAAR F + G+  G L I++KEA APYERPAL+KAYLFP  +  ARLPGFH CVG GGER  P+WYKEKGIE+I    +  AD   +TL +  G   KY  L+IATG T  R  D    G     + Y+RE+ DAD L+                 YIG+E++AA    N+D ++V+PE   + RLFT  +A  YE  Y   G + +KG
Sbjct:   55 SFANENREFVIVGGGNAAGYAARTFVENGMADGRLCIVTKEAYAPYERPALTKAYLFPPEKKPARLPGFHTCVGGGGERQTPDWYKEKGIEVIYEDPVAGADFEKQTLTTDAGKQLKYGSLIIATGCTASRFPD--KIGGHLPGVHYIREVADADSLI--ASLGKAKKIVIVGGGYIGMEVAAAAVAWNLDTTIVFPEDQLLQRLFTPSLAQKYEELYRQNGVKFVKG 278          
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: RURE_PSEOL (Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans GN=alkT PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.686e-14
Identity = 65/201 (32.34%), Postives = 98/201 (48.76%), Query Frame = 3
Query:   45 VILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPE-WYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDAD----KLVEXXXXXXXXXXXXXXXXYIGLELSAALKINNIDVSMVYPEPWCMPRLFT 632
            V++G G +   AA    + G K GE+ I S+E+VAPY+RP LSKA+L  E           +      L PE +Y    I + L+T IV  D+  K + S  G  + Y+ L++AT ++  RLT    EG++   + YLR ++DA     KLVE                 IGLE+++A       V+++   P  M R+ T
Sbjct:    4 VVVGAGTAGVNAAFWLRQYGYK-GEIRIFSRESVAPYQRPPLSKAFLTSE-----------IAESAVPLKPEGFYTNNNITISLNTPIVSIDVGRKIVSSKDGKEYAYEKLILATPASARRLT---CEGSELSGVCYLRSMEDAKNLRRKLVE------SASVVVLGGGVIGLEVASAAVGLGKRVTVIEATPRVMARVVT 183          
BLAST of FC931398 vs. ExPASy Swiss-Prot
Match: YDGE_SCHPO (Putative flavoprotein C26F1.14C OS=Schizosaccharomyces pombe GN=SPAC26F1.14c PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 5.076e-11
Identity = 54/183 (29.51%), Postives = 82/183 (44.81%), Query Frame = 3
Query:   48 ILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLL--SATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVE-XXXXXXXXXXXXXXXXYIGLELSAALKINNIDV 587
            I+GGG  A  AA    ++  K G++ I ++E   PY+RP LSK+ L       L                E+Y +  I    +T++ + D+A K +   S       Y  L++ATG    +L    + G D+KN++ LR I DA KL                   +IGLEL+  LK +N+ V
Sbjct:  162 IIGGGKGASVAAEYLREKNFK-GKITIFTREDEVPYDRPKLSKSLLHDISKLALRS-------------KEYYDDLDISFHFNTDVTKIDLAEKKIYCGSDEKPTESYTKLILATGGEPNKLP---IPGLDSKNVYLLRSIADASKLAAVTTEAGDKKNIVIIGSSFIGLELAVVLKDHNVSV 327          
The following BLAST results are available for this feature:
BLAST of FC931398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
MDAR_SOLLC2.373e-10180.43Monodehydroascorbate reductase OS=Solanum lycopers... [more]
MDAR3_ARATH2.901e-9977.83Probable monodehydroascorbate reductase, cytoplasm... [more]
MDARS_CUCSA4.188e-9877.39Monodehydroascorbate reductase, seedling isozyme O... [more]
MDAR_PEA5.661e-9576.99Monodehydroascorbate reductase OS=Pisum sativum PE... [more]
MDAR4_ARATH7.411e-8769.74Probable monodehydroascorbate reductase, cytoplasm... [more]
MDAR1_ARATH1.959e-7158.52Probable monodehydroascorbate reductase, cytoplasm... [more]
MDAR2_ARATH1.230e-6554.71Probable monodehydroascorbate reductase, cytoplasm... [more]
MDARP_ARATH3.044e-4845.61Monodehydroascorbate reductase, chloroplastic OS=A... [more]
RURE_PSEOL1.686e-1432.34Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovor... [more]
YDGE_SCHPO5.076e-1129.51Putative flavoprotein C26F1.14C OS=Schizosaccharom... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34104F11EF PostHarvP1 Citrus clementina cDNA clone C34104F11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931398 ID=FC931398|Name=FC931398|organism=Citrus clementina|type=EST|length=712bp
GAACTTTTTTCGATCGATCAATGGCGGAGAAGAGCTTCAAGTACGTGATC
CTCGGTGGCGGTGTCTCTGCTGGATATGCAGCTAGGGAGTTTGCTAAGCA
GGGTGTTAAGCCAGGCGAGCTGGCAATTATCTCCAAAGAAGCGGTTGCTC
CGTATGAGCGTCCAGCACTTAGCAAGGCATATCTTTTCCCTGAGGGAACT
GCTAGACTTCCCGGTTTCCATGTCTGTGTTGGAAGTGGTGGAGAGAGACT
GCTTCCTGAGTGGTACAAAGAGAAAGGAATCGAATTGATCCTCAGCACGG
AAATAGTCAGAGCAGATATTGCTTCCAAGACTCTCCTTAGTGCAACTGGG
CTTATCTTTAAGTACCAGATTTTAGTAATTGCAACTGGTTCTACAGTTTT
ACGGTTGACTGATTTTGGTGTTGAAGGTGCTGATGCCAAAAATATCTTCT
ACTTAAGAGAAATTGATGATGCTGATAAGCTGGTTGAAGCAATAAAAGCA
AAGAAGAATGGGAAGGCAGTGGTTGTTGGAGGAGGATACATTGGTCTTGA
GCTTAGTGCAGCTTTAAAAATAAATAATATTGATGTTAGCATGGTTTATC
CTGAACCATGGTGCATGCCTCGTCTTTTCACTGCGGATATTGCTGCTTTC
TATGAGGGTTATTATGCCAATAAAGGAAATCAAATTATTAAGGGAACAGN
TGCTGTTGGATT
back to top