FC931405

Overview
NameFC931405
Unique NameFC931405
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length724
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15299 contig Ccv1_Contig15299:1..726. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB7B_ARATH (Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2)

HSP 1 Score: 330.487 bits (846), Expect = 3.464e-93
Identity = 157/182 (86.26%), Postives = 172/182 (94.51%), Query Frame = 3
Query:  126 MSNSAIDVPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYK 671
            MS S++D+P +GGFSFDLC+RNDML +KG+  PSF KTGTTIVGLIF+DGVILGADTRATEGPIV DKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQL+LHRY TGR+SRVVTALTLLKKHLF+YQG+V AALVLGGVD TGPHLHTIYPHGSTDTLPFATMGSGSLAAM++FE+KYK
Sbjct:    1 MSQSSVDIPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVVTALTLLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYK 182          

HSP 2 Score: 33.113 bits (74), Expect = 3.464e-93
Identity = 14/17 (82.35%), Postives = 17/17 (100.00%), Query Frame = 1
Query:  673 GLTKDEGIQLVADAICS 723
            GLT+DEGI+LVA+AICS
Sbjct:  184 GLTRDEGIKLVAEAICS 200          
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB7A_ARATH (Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2)

HSP 1 Score: 330.102 bits (845), Expect = 1.003e-92
Identity = 157/182 (86.26%), Postives = 171/182 (93.96%), Query Frame = 3
Query:  126 MSNSAIDVPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYK 671
            MS S +DVP +GGFSFDLC+RNDML +KG+  PSF KTGTTIVGLIF+DGVILGADTRATEGPIV DKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQL+LHRY TGR+SRV+TALTLLKKHLF+YQG+V AALVLGGVD TGPHLHTIYPHGSTDTLPFATMGSGSLAAM++FE+KYK
Sbjct:    1 MSQSTVDVPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVITALTLLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYK 182          

HSP 2 Score: 31.9574 bits (71), Expect = 1.003e-92
Identity = 13/17 (76.47%), Postives = 17/17 (100.00%), Query Frame = 1
Query:  673 GLTKDEGIQLVADAICS 723
            GLT+DEGI+LVA++ICS
Sbjct:  184 GLTRDEGIKLVAESICS 200          
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB7_DICDI (Proteasome subunit beta type-7 OS=Dictyostelium discoideum GN=psmB7 PE=3 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 8.451e-71
Identity = 120/173 (69.36%), Postives = 150/173 (86.71%), Query Frame = 3
Query:  153 SRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYK 671
            +RGGF FDLC RN++L K G+ +  F KTGTTIVG++++ GV+LGADTRATEGPIV DKNCEKIHY+A NIYCCGAGTAADTE+ T ++SS+L+LH+  TG+++RV+TALT+LK+ LF YQG++ AAL+LGG+D  GP LHTIYPHGSTD LP+ TMGSGSLAAMA+FE+KYK
Sbjct:    5 NRGGFDFDLCNRNNVLEKTGLRMKGFMKTGTTIVGVVYKGGVVLGADTRATEGPIVADKNCEKIHYIADNIYCCGAGTAADTESATALISSKLKLHKLSTGKQTRVITALTMLKQMLFKYQGHISAALILGGIDINGPSLHTIYPHGSTDQLPYVTMGSGSLAAMAVFEAKYK 177          

HSP 2 Score: 22.7126 bits (47), Expect = 8.451e-71
Identity = 10/16 (62.50%), Postives = 13/16 (81.25%), Query Frame = 1
Query:  676 LTKDEGIQLVADAICS 723
            +TK+E I LVA+AI S
Sbjct:  180 MTKEEAIALVAEAISS 195          
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB7_HUMAN (Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.900e-67
Identity = 123/189 (65.08%), Postives = 150/189 (79.37%), Query Frame = 3
Query:  126 MSNSAIDVPSRGGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKRPD 680
            M+  ++  P  GGFSFD CRRN +L    AK+G  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K+ RPD
Sbjct:    1 MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKF-RPD 188          
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB7_MOUSE (Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 5.094e-67
Identity = 124/189 (65.61%), Postives = 150/189 (79.37%), Query Frame = 3
Query:  126 MSNSAIDVPSRGGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKRPD 680
            M+  ++  P  GGFSFD CRRN +L    AKKG  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K+ RPD
Sbjct:    1 MAAVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKF-RPD 188          
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB7_BOVIN (Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 6.653e-67
Identity = 125/188 (66.49%), Postives = 151/188 (80.32%), Query Frame = 3
Query:  135 SAIDVPSR--GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKRPD 680
            +A+ V  R  GGFSFD CRRN +L    AKKG  LP+ RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K+ RPD
Sbjct:    2 AAVSVYERPVGGFSFDNCRRNAVLEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKF-RPD 188          
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB7_RAT (Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 1.482e-66
Identity = 122/178 (68.54%), Postives = 145/178 (81.46%), Query Frame = 3
Query:  159 GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKRPD 680
            GGFSFD CRRN +L    AKKG  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K+ RPD
Sbjct:   12 GGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKF-RPD 188          
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB7_PIG (Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2)

HSP 1 Score: 252.292 bits (643), Expect = 1.936e-66
Identity = 122/185 (65.95%), Postives = 149/185 (80.54%), Query Frame = 3
Query:  135 SAIDVPSR--GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYK 671
            +A+ V  R  GGFSFD CRRN +L    AKKG  LP+ RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K++
Sbjct:    2 AAVSVYERPVGGFSFDNCRRNAILEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFR 186          
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB7_SCHPO (Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe GN=SPAC23D3.07 PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.659e-57
Identity = 105/178 (58.99%), Postives = 137/178 (76.97%), Query Frame = 3
Query:  147 VPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKRPD 680
            +  R GF F+  +RN +L +KG   P    TGTTIVG+I +D ++LGADTRAT GPI+ DKNC+K+H ++PNI+C GAGTAADTE VT M+SS ++LH  +T R+ RVVTALT+LK+HLF YQG++ A LVLGG DC GPHL TI  HGS+D LP+  +GSGSLAA+++ E+KY +PD
Sbjct:    4 INERKGFDFEYYQRNLLLQEKGFPTPKATSTGTTIVGVIAKDCIVLGADTRATAGPIIADKNCKKLHLISPNIWCAGAGTAADTEFVTSMISSNIELHSLYTNRKPRVVTALTMLKQHLFRYQGHIGAYLVLGGYDCKGPHLFTIAAHGSSDKLPYVALGSGSLAAISVLETKY-QPD 180          
BLAST of FC931405 vs. ExPASy Swiss-Prot
Match: PSB10_HUMAN (Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.220e-54
Identity = 100/174 (57.47%), Postives = 130/174 (74.71%), Query Frame = 3
Query:  156 RGGFSFDLCRRNDMLAK--KGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYK 671
            RGGFSF+ C+RN  L +   G+ +P  RKTGTTI GL+FQDGVILGADTRAT   +V DK+CEKIH++AP IYCCGAG AAD E  T MV+S+++LH   TGRE RV T   +L++ LF YQG+V A+L++GGVD TGP L+ ++PHGS   LPF  +GSG  AA+A+ E +++
Sbjct:    9 RGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQ 182          
The following BLAST results are available for this feature:
BLAST of FC931405 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
PSB7B_ARATH3.464e-9386.26Proteasome subunit beta type-7-B OS=Arabidopsis th... [more]
PSB7A_ARATH1.003e-9286.26Proteasome subunit beta type-7-A OS=Arabidopsis th... [more]
PSB7_DICDI8.451e-7169.36Proteasome subunit beta type-7 OS=Dictyostelium di... [more]
PSB7_HUMAN3.900e-6765.08Proteasome subunit beta type-7 OS=Homo sapiens GN=... [more]
PSB7_MOUSE5.094e-6765.61Proteasome subunit beta type-7 OS=Mus musculus GN=... [more]
PSB7_BOVIN6.653e-6766.49Proteasome subunit beta type-7 OS=Bos taurus GN=PS... [more]
PSB7_RAT1.482e-6668.54Proteasome subunit beta type-7 OS=Rattus norvegicu... [more]
PSB7_PIG1.936e-6665.95Proteasome subunit beta type-7 OS=Sus scrofa GN=PS... [more]
PSB7_SCHPO3.659e-5758.99Probable proteasome subunit beta type-7 OS=Schizos... [more]
PSB10_HUMAN2.220e-5457.47Proteasome subunit beta type-10 OS=Homo sapiens GN... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34104G06EF PostHarvP1 Citrus clementina cDNA clone C34104G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931405 ID=FC931405|Name=FC931405|organism=Citrus clementina|type=EST|length=724bp
TTCTTTCGTTTTAAGTTTTTAAGACTCGAAGTCGCTCGCTGTCGCTCGCT
GTCGCTGCTGCTCTCCAAAGCTCACGCCTTGTTTTCATTCCAGTGGGATC
AATCTCAGGTTGAAGAAAGTTTAAAATGTCAAACTCTGCAATAGATGTTC
CTTCCAGGGGTGGATTTAGTTTTGATCTCTGCCGGCGGAATGATATGCTT
GCAAAGAAGGGTGTCAACCTTCCATCTTTCCGAAAGACGGGGACGACCAT
TGTTGGGTTGATTTTCCAGGATGGCGTCATTCTTGGGGCAGATACCAGAG
CAACTGAAGGACCCATAGTTTGCGATAAGAATTGTGAGAAAATTCATTAC
ATGGCTCCAAACATATATTGTTGTGGTGCAGGAACTGCTGCTGACACAGA
GGCTGTAACTGACATGGTCAGCTCACAGCTGCAGTTACATCGTTATCATA
CTGGTAGAGAGTCAAGGGTTGTTACAGCACTGACTCTTCTCAAGAAGCAC
CTTTTCAACTACCAAGGTTATGTGCAAGCTGCTTTGGTTCTTGGTGGAGT
TGATTGCACTGGACCTCATCTTCACACAATATATCCACATGGTTCAACTG
ACACTTTGCCATTTGCGACAATGGGTTCTGGTTCTCTTGCTGCCATGGCT
ATGTTTGAATCAAAATACAAGAGGCCTGACTAAAGATGAGGGAATACAGC
TAGTTGCGGACGCCATTTGCTCTG
back to top