FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: LRKA3_ARATH (Lectin-domain containing receptor kinase A4.3 OS=Arabidopsis thaliana GN=LECRKA4.3 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 5.694e-76
Identity = 131/220 (59.55%), Postives = 175/220 (79.55%), Query Frame = 3
Query:    3 HRFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK---VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            HRFRY+DLY AT+GF+E  ++G+GGFG VYRG +  S  +IAVKKI+  S QG++EFVAEI S+GRLRH+NLV L G+C+ + +LLL+YDY+PNGSLD  LY++P+     L+W  R+ + KG+A GLLYLHEEWEQ+VIHRDVK SNVL+D ++N RLGDFGLARLY+ G+   TT VVGT+GY+APE +R G +++++DVF+FG  LLE+  GR+P +
Sbjct:  349 HRFRYRDLYKATEGFKENRVVGTGGFGIVYRGNIRSSSDQIAVKKITPNSMQGVREFVAEIESLGRLRHKNLVNLQGWCKHRNDLLLIYDYIPNGSLDSLLYSKPRRSGAVLSWNARFQIAKGIASGLLYLHEEWEQIVIHRDVKPSNVLIDSDMNPRLGDFGLARLYERGSQSCTTVVVGTIGYMAPELARNGNSSSASDVFAFGVLLLEIVSGRKPTD 568          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: LRKA2_ARATH (Lectin-domain containing receptor kinase A4.2 OS=Arabidopsis thaliana GN=LECRKA4.2 PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.657e-75
Identity = 132/221 (59.73%), Postives = 176/221 (79.64%), Query Frame = 3
Query:    3 HRFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPK-SKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK---VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            HR RYKDLY AT GF+E  ++G+GGFG V+RG L   S  +IAVKKI+  S QG++EF+AEI S+GRLRH+NLV L G+C++K +LLL+YDY+PNGSLD  LY++P+   V L+W  R+ + KG+A GLLYLHEEWE+VVIHRD+K SNVL++ ++N RLGDFGLARLY+ G+   TT VVGT+GY+APE +R GK+++++DVF+FG  LLE+  GRRP +
Sbjct:  347 HRLRYKDLYAATDGFKENRIVGTGGFGTVFRGNLSSPSSDQIAVKKITPNSMQGVREFIAEIESLGRLRHKNLVNLQGWCKQKNDLLLIYDYIPNGSLDSLLYSRPRQSGVVLSWNARFKIAKGIASGLLYLHEEWEKVVIHRDIKPSNVLIEDDMNPRLGDFGLARLYERGSQSNTTVVVGTIGYMAPELARNGKSSSASDVFAFGVLLLEIVSGRRPTD 567          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: LRKA1_ARATH (Lectin-domain containing receptor kinase A4.1 OS=Arabidopsis thaliana GN=LECRKA4.1 PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 3.124e-74
Identity = 130/219 (59.36%), Postives = 172/219 (78.54%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK---VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            R RY+DLY+AT GF++  ++G+GGFG V++G LP S   IAVKKI   SRQG++EFVAEI S+G+LRH+NLV L G+C+ K +LLL+YDY+PNGSLD  LY  P+     L+W  R+ + KG+A GLLYLHEEWE++VIHRDVK SNVL+D ++N RLGDFGLARLY+ GT  +TT +VGT+GY+APE SR G  ++++DVF+FG  LLE+ CGR+P +
Sbjct:  354 RLRYRDLYVATDGFKKTGIIGTGGFGTVFKGKLPNSD-PIAVKKIIPSSRQGVREFVAEIESLGKLRHKNLVNLQGWCKHKNDLLLIYDYIPNGSLDSLLYTVPRRSGAVLSWNARFQIAKGIASGLLYLHEEWEKIVIHRDVKPSNVLIDSKMNPRLGDFGLARLYERGTLSETTALVGTIGYMAPELSRNGNPSSASDVFAFGVLLLEIVCGRKPTD 571          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK37_ARATH (Cysteine-rich receptor-like protein kinase 37 OS=Arabidopsis thaliana GN=CRK37 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 6.126e-54
Identity = 108/225 (48.00%), Postives = 158/225 (70.22%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR--RPIERQSQK 668
            RF  + +  AT  F  +  LG GGFG VY+G LP  + EIAVK++   S QG  EF  E++ + RL+HRNLV+LLG+C  K E +LVY+++PN SLD +++++ K   L W  RY +I+GVA GLLYLHE+ +  +IHRD+KASN+LLD E+N ++ DFG+ARL+D   T  QT+ VVGT GY+APE++  G+ +T +DV+SFG  LLE+  G+  + +E++ ++
Sbjct:  332 RFDLRMIVTATNNFSLENKLGQGGFGSVYKGILPSGQ-EIAVKRLRKGSGQGGMEFKNEVLLLTRLQHRNLVKLLGFCNEKDEEILVYEFVPNSSLDHFIFDEEKRRVLTWDVRYTIIEGVARGLLYLHEDSQLRIIHRDLKASNILLDAEMNPKVADFGMARLFDMDETRGQTSRVVGTYGYMAPEYATYGQFSTKSDVYSFGVMLLEMISGKSNKKLEKEEEE 555          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK8_ARATH (Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=2)

HSP 1 Score: 208.379 bits (529), Expect = 3.040e-53
Identity = 101/212 (47.64%), Postives = 147/212 (69.34%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            Y+ +  AT  F E   +G GGFG VY+GT    K E+AVK++S  SRQG  EF  E+V + +L+HRNLV+LLG+  +  E +LVY+YMPN SLD  L++  K T L+W QRY +I G+A G+LYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR++    T   T+ +VGT GY+APE++  G+ +  +DV+SFG  +LE+  GR+
Sbjct:  343 YRTIQTATNDFAESNKIGRGGFGEVYKGTFSNGK-EVAVKRLSKNSRQGEAEFKTEVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDCLLFDPTKQTQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKIADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEIISGRK 553          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK6_ARATH (Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.971e-53
Identity = 100/212 (47.17%), Postives = 147/212 (69.34%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK-VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            Y+ +  AT  F E   +G GGFG VY+GT    K E+AVK++S  SRQG  EF  E+V + +L+HRNLV+LLG+  +  E +LVY+YMPN SLD  L++  K + L+W QRY +I G+A G+LYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR++    T   T+ +VGT GY+APE++  G+ +  +DV+SFG  +LE+  GR+
Sbjct:  341 YRTIQTATNDFAESNKIGRGGFGEVYKGTFSNGK-EVAVKRLSKNSRQGEAEFKTEVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDCLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKIADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEIISGRK 551          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK31_ARATH (Putative cysteine-rich receptor-like protein kinase 31 OS=Arabidopsis thaliana GN=CRK31 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 6.773e-53
Identity = 99/215 (46.05%), Postives = 151/215 (70.23%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYN-QPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +  + +AT  F     LG GGFG VY+G LP ++ EIAVK++S  S QG +EF  E+V + +L+H+NLV+LLG+C  + E +LVY+++ N SLD +L++ + K  L+W++RY +I GV  GLLYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR +    T+ QT  VVGT GY+ PE+   G+ +T +DV+SFG  +LE+ CG++
Sbjct:  326 QFDFTTIEVATDNFSRNNKLGQGGFGEVYKGMLP-NETEIAVKRLSSNSGQGTQEFKNEVVIVAKLQHKNLVRLLGFCIERDEQILVYEFVSNKSLDYFLFDPKMKSQLDWKRRYNIIGGVTRGLLYLHQDSRLTIIHRDIKASNILLDADMNPKIADFGMARNFRVDQTEDQTGRVVGTFGYMPPEYVTHGQFSTKSDVYSFGVLILEIVCGKK 539          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y5614_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 1.971e-52
Identity = 106/213 (49.77%), Postives = 141/213 (66.20%), Query Frame = 3
Query:    3 HRFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            + F Y +L  AT+ F     LG GGFG VY+G L   + E+AVK +S  SRQG  +FVAEIV+I  ++HRNLV+L G C      LLVY+Y+PNGSLD+ L+ +  + L+W  RY +  GVA GL+YLHEE    ++HRDVKASN+LLD +L  ++ DFGLA+LYD      +T V GT+GYLAPE++  G  T   DV++FG   LE+  GR
Sbjct:  679 YTFTYSELKSATQDFDPSNKLGEGGFGPVYKGKLNDGR-EVAVKLLSVGSRQGKGQFVAEIVAISAVQHRNLVKLYGCCYEGEHRLLVYEYLPNGSLDQALFGEKTLHLDWSTRYEICLGVARGLVYLHEEARLRIVHRDVKASNILLDSKLVPKVSDFGLAKLYDDKKTHISTRVAGTIGYLAPEYAMRGHLTEKTDVYAFGVVALELVSGR 890          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK36_ARATH (Cysteine-rich receptor-like protein kinase 36 OS=Arabidopsis thaliana GN=CRK36 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.277e-51
Identity = 105/215 (48.84%), Postives = 150/215 (69.77%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            RF    + IAT  F  +  LG GGFG VY+G LP  + EIAVK+++  S QG  EF  E++ + RL+HRNLV+LLG+C    E +LVY+++PN SLD +++++ K   L W  RY +I+GVA GLLYLHE+ +  +IHRD+KASN+LLD E+N ++ DFG+ARL++   T  +T+ VVGT GY+APE+ R G+ +  +DV+SFG  LLE+  G +
Sbjct:  327 RFDLGMILIATNEFSLENKLGQGGFGSVYKGILPSGQ-EIAVKRLAGGSGQGELEFKNEVLLLTRLQHRNLVKLLGFCNEGNEEILVYEHVPNSSLDHFIFDEDKRWLLTWDVRYRIIEGVARGLLYLHEDSQLRIIHRDLKASNILLDAEMNPKVADFGMARLFNMDETRGETSRVVGTYGYMAPEYVRHGQFSAKSDVYSFGVMLLEMISGEK 540          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y1561_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 3.716e-51
Identity = 104/211 (49.29%), Postives = 137/211 (64.93%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            F Y +L  AT+ F     LG GGFG VY+G L   ++ +AVK +S  SRQG  +FVAEIV+I  + HRNLV+L G C      +LVY+Y+PNGSLD+ L+    + L+W  RY +  GVA GL+YLHEE    ++HRDVKASN+LLD  L  ++ DFGLA+LYD      +T V GT+GYLAPE++  G  T   DV++FG   LE+  GR
Sbjct:  682 FTYSELKSATQDFDPSNKLGEGGFGPVYKGNLNDGRV-VAVKLLSVGSRQGKGQFVAEIVAISSVLHRNLVKLYGCCFEGEHRMLVYEYLPNGSLDQALFGDKTLHLDWSTRYEICLGVARGLVYLHEEASVRIVHRDVKASNILLDSRLVPQISDFGLAKLYDDKKTHISTRVAGTIGYLAPEYAMRGHLTEKTDVYAFGVVALELVSGR 891          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
LRKA3_ARATH5.694e-7659.55Lectin-domain containing receptor kinase A4.3 OS=A... [more]
LRKA2_ARATH1.657e-7559.73Lectin-domain containing receptor kinase A4.2 OS=A... [more]
LRKA1_ARATH3.124e-7459.36Lectin-domain containing receptor kinase A4.1 OS=A... [more]
CRK37_ARATH6.126e-5448.00Cysteine-rich receptor-like protein kinase 37 OS=A... [more]
CRK8_ARATH3.040e-5347.64Cysteine-rich receptor-like protein kinase 8 OS=Ar... [more]
CRK6_ARATH3.971e-5347.17Cysteine-rich receptor-like protein kinase 6 OS=Ar... [more]
CRK31_ARATH6.773e-5346.05Putative cysteine-rich receptor-like protein kinas... [more]
Y5614_ARATH1.971e-5249.77Probable LRR receptor-like serine/threonine-protei... [more]
CRK36_ARATH1.277e-5148.84Cysteine-rich receptor-like protein kinase 36 OS=A... [more]
Y1561_ARATH3.716e-5149.29Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top