FC931444

Overview
NameFC931444
Unique NameFC931444
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length679
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931444_ssr75 microsatellite FC931444_ssr75:75..86. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC931444 vs. ExPASy Swiss-Prot
Match: CI078_MOUSE (Uncharacterized protein C9orf78 homolog OS=Mus musculus PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.982e-13
Identity = 50/140 (35.71%), Postives = 83/140 (59.29%), Query Frame = 2
Query:  269 LTKVSEKNEGD-GEKDELVLQDTFAQETAVMVEDPNMLKYVEQELAKKRGKNIDVNDRVENDLKHAEDELYKIPEHLKVK--KRNSEESSTQWTTGIAEVQLPIEYKLKNIEETEAAK-KLLQEKRLMGRAKSDFSIPSS 676
            + K+ E+ +    E+++L L  +F+ ET    ED +M+KY+E EL K++G  I   +  +   K+AED LY++PE+++V   K+  E  S Q  +GI EV L I+ K+KNI  TE AK +LL E++   +      +P++
Sbjct:   79 MKKLKERGKDKVSEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKG--IVEQEEQKAKPKNAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTN 216          
BLAST of FC931444 vs. ExPASy Swiss-Prot
Match: CI078_HUMAN (Uncharacterized protein C9orf78 OS=Homo sapiens GN=C9orf78 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.982e-13
Identity = 50/140 (35.71%), Postives = 84/140 (60.00%), Query Frame = 2
Query:  269 LTKVSEKNEGD-GEKDELVLQDTFAQETAVMVEDPNMLKYVEQELAKKRGKNIDVNDRVENDLKHAEDELYKIPEHLKVK--KRNSEESSTQWTTGIAEVQLPIEYKLKNIEETEAAK-KLLQEKRLMGRAKSDFSIPSS 676
            + K+ E+ +    E+++L L  +F+ ET    ED +M+KY+E EL K++G  I  ++  +   K+AED LY++PE+++V   K+  E  S Q  +GI EV L I+ K+KNI  TE AK +LL E++   +      +P++
Sbjct:   79 MKKLKERGKDKISEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKG--IVEHEEQKVKPKNAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTN 216          
BLAST of FC931444 vs. ExPASy Swiss-Prot
Match: CI078_PONAB (Uncharacterized protein C9orf78 homolog OS=Pongo abelii PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.472e-12
Identity = 49/140 (35.00%), Postives = 83/140 (59.29%), Query Frame = 2
Query:  269 LTKVSEKNEGD-GEKDELVLQDTFAQETAVMVEDPNMLKYVEQELAKKRGKNIDVNDRVENDLKHAEDELYKIPEHLKVK--KRNSEESSTQWTTGIAEVQLPIEYKLKNIEETEAAK-KLLQEKRLMGRAKSDFSIPSS 676
            + K+ E+ +    E+++L L  +F+ ET    ED +M+KY+E EL K++G  I  ++  +   K+AED LY++PE+++V   K+  E  S Q  +GI EV   I+ K+KNI  TE AK +LL E++   +      +P++
Sbjct:   79 MKKLKERGKDKISEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKG--IVEHEEQKVKPKNAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDQGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTN 216          
The following BLAST results are available for this feature:
BLAST of FC931444 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CI078_MOUSE4.982e-1335.71Uncharacterized protein C9orf78 homolog OS=Mus mus... [more]
CI078_HUMAN4.982e-1335.71Uncharacterized protein C9orf78 OS=Homo sapiens GN... [more]
CI078_PONAB2.472e-1235.00Uncharacterized protein C9orf78 homolog OS=Pongo a... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34105B09EF PostHarvP1 Citrus clementina cDNA clone C34105B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931444 ID=FC931444|Name=FC931444|organism=Citrus clementina|type=EST|length=679bp
GGCATAGATTTTGTATTTTCAGATTTTAGAATTAATAGAGAAATTAATGG
AAAATCCGATACCGCAGAAGAAGGAGAAGAAGAAGAATTTCAGAAAGAGG
AGTTACGAAGAAGAGGAGGAAACCACGAACAAGTTATCAGATGACGAAGA
AGAAAGGAGGTTGGCATTGGAAGAAATTAAGTTTCTTCAAAAACAAAGAG
AAAGAAAATCAGGAATACCGGCAATACCGAGTGCACTACAAAGTGCAGCA
GCCGCTGGCGGCGGCGGTTTAACTAAAGTTAGTGAAAAGAACGAGGGAGA
TGGGGAGAAAGACGAATTGGTCCTTCAAGATACCTTCGCTCAAGAAACTG
CTGTTATGGTTGAAGATCCCAACATGTTGAAGTACGTTGAGCAAGAACTG
GCCAAGAAAAGGGGAAAGAATATTGATGTGAACGATCGAGTTGAGAATGA
TTTAAAGCACGCTGAAGATGAATTATACAAGATCCCAGAGCATCTTAAGG
TAAAGAAAAGAAACTCAGAAGAAAGCTCTACGCAGTGGACTACAGGGATA
GCTGAGGTTCAGCTCCCGATTGAATACAAGTTGAAGAATATCGAGGAAAC
TGAAGCTGCCAAAAAGCTTCTACAAGAAAAGAGACTCATGGGTAGAGCAA
AATCAGATTTTAGCATCCCCTCAAGTTAC
back to top