FC931767

Overview
NameFC931767
Unique NameFC931767
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length692
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15503 contig Ccv1_Contig15503:27..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_ROSDO (30S ribosomal protein S16 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsP PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.336e-20
Identity = 47/82 (57.32%), Postives = 63/82 (76.83%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGL 676
            M ++IRLAR G K +PFYR++AADSR PRDG+ +E LG YNPL  +DS +R+ ++ +RV+YWL  GAQP+D V R+L  AGL
Sbjct:    1 MAMKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDAERVQYWLGQGAQPTDRVARMLEAAGL 82          
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_SPHWW (30S ribosomal protein S16 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsP PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.357e-20
Identity = 47/82 (57.32%), Postives = 60/82 (73.17%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGL 676
            M V IRLAR G K +P+YR++ AD+RSPRDG  +E +G YNPL  +D  KR+ L+ DR K+WLSVGAQP+D V R L  AG+
Sbjct:    1 MAVSIRLARGGAKKRPYYRIVVADARSPRDGAFIEKIGAYNPLLAKDDPKRVVLDTDRAKHWLSVGAQPTDRVARFLDAAGV 82          
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_DINSH (30S ribosomal protein S16 OS=Dinoroseobacter shibae (strain DFL 12) GN=rpsP PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 9.705e-20
Identity = 46/84 (54.76%), Postives = 63/84 (75.00%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGLLP 682
            M ++IRLAR G K +PFYR++AADSR PRDG+ +E LG YNPL  +DS  R+ ++ +RV+YWL  GA+P+D V R+L  A +LP
Sbjct:    1 MAMKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEDRVKMDLERVQYWLGEGAKPTDRVARMLEAAEVLP 84          
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_SILPO (30S ribosomal protein S16 OS=Silicibacter pomeroyi GN=rpsP PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.268e-19
Identity = 46/83 (55.42%), Postives = 64/83 (77.11%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGLL 679
            M ++IRLAR G K +PFYR++AADSR PRDG+ +E LG YNPL  +DS +R+ ++ +RV+YWLS GAQ +D V R+L  AG++
Sbjct:    1 MAMKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLPKDSEERVKMDVERVQYWLSQGAQTTDRVARMLEAAGVV 83          
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_RHOS5 (30S ribosomal protein S16 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsP PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.268e-19
Identity = 47/82 (57.32%), Postives = 60/82 (73.17%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGL 676
            M ++IRLAR G K +P Y ++A+DSR PRDG+ LE LG YNPL  +DS  R+ +N +RV+YWLS GAQP+D V R L  AGL
Sbjct:    1 MAMKIRLARGGSKKRPHYSIVASDSRMPRDGRFLEKLGTYNPLLAKDSEDRIKMNVERVQYWLSQGAQPTDRVARFLEAAGL 82          
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_RHOS4 (30S ribosomal protein S16 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsP PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.162e-19
Identity = 46/82 (56.10%), Postives = 60/82 (73.17%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGL 676
            M ++IRLAR G K +P Y ++A+DSR PRDG+ LE LG YNPL  +DS  R+ +N +RV+YWL+ GAQP+D V R L  AGL
Sbjct:    1 MAMKIRLARGGSKKRPHYSIVASDSRMPRDGRFLEKLGTYNPLLAKDSEDRIKMNLERVQYWLAQGAQPTDRVARFLEAAGL 82          
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_RHOS1 (30S ribosomal protein S16 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsP PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.162e-19
Identity = 46/82 (56.10%), Postives = 60/82 (73.17%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGL 676
            M ++IRLAR G K +P Y ++A+DSR PRDG+ LE LG YNPL  +DS  R+ +N +RV+YWL+ GAQP+D V R L  AGL
Sbjct:    1 MAMKIRLARGGSKKRPHYSIVASDSRMPRDGRFLEKLGTYNPLLAKDSEDRIKMNLERVQYWLAQGAQPTDRVARFLEAAGL 82          
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_RHOPS (30S ribosomal protein S16 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsP PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.688e-19
Identity = 47/82 (57.32%), Postives = 59/82 (71.95%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGL 676
            M V IRLAR G K +PFY V+ ADSR PRDG+ +E LGY+NPL  +D+  R+ L+ D+VK WL+ GAQPSD V R L  AG+
Sbjct:    1 MSVVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMAKDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGI 82          
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_RHIME (30S ribosomal protein S16 OS=Rhizobium meliloti GN=rpsP PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.688e-19
Identity = 43/82 (52.44%), Postives = 63/82 (76.83%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGL 676
            M ++IRLAR G K +P+Y+++ AD+RSPRDG+ LE LG +NP+  +D  KR+ LN +RV++W++ GAQP+D V R L +AGL
Sbjct:    1 MALKIRLARGGSKKRPYYQIVVADARSPRDGRFLEKLGSWNPMLAKDDEKRIELNAERVQHWIAQGAQPTDRVMRFLDQAGL 82          
BLAST of FC931767 vs. ExPASy Swiss-Prot
Match: RS16_RHOPT (30S ribosomal protein S16 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsP PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.817e-19
Identity = 47/82 (57.32%), Postives = 59/82 (71.95%), Query Frame = 2
Query:  431 MVVRIRLARFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDSGKRMGLNFDRVKYWLSVGAQPSDPVQRILFRAGL 676
            M V IRLAR G K +PFY V+ ADSR PRDG+ +E LGY+NPL  +D+  R+ L+ D+VK WL+ GAQPSD V R L  AG+
Sbjct:    1 MSVVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMAKDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGV 82          
The following BLAST results are available for this feature:
BLAST of FC931767 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RS16_ROSDO3.336e-2057.3230S ribosomal protein S16 OS=Roseobacter denitrifi... [more]
RS16_SPHWW4.357e-2057.3230S ribosomal protein S16 OS=Sphingomonas wittichi... [more]
RS16_DINSH9.705e-2054.7630S ribosomal protein S16 OS=Dinoroseobacter shiba... [more]
RS16_SILPO1.268e-1955.4230S ribosomal protein S16 OS=Silicibacter pomeroyi... [more]
RS16_RHOS51.268e-1957.3230S ribosomal protein S16 OS=Rhodobacter sphaeroid... [more]
RS16_RHOS42.162e-1956.1030S ribosomal protein S16 OS=Rhodobacter sphaeroid... [more]
RS16_RHOS12.162e-1956.1030S ribosomal protein S16 OS=Rhodobacter sphaeroid... [more]
RS16_RHOPS3.688e-1957.3230S ribosomal protein S16 OS=Rhodopseudomonas palu... [more]
RS16_RHIME3.688e-1952.4430S ribosomal protein S16 OS=Rhizobium meliloti GN... [more]
RS16_RHOPT4.817e-1957.3230S ribosomal protein S16 OS=Rhodopseudomonas palu... [more]

Pages

back to top
Libraries
Library NameType
PostHarveNcdna_library
Properties
Property NameValue
Genbank descriptionC34201A03EF PostHarveN Citrus clementina cDNA clone C34201A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931767 ID=FC931767|Name=FC931767|organism=Citrus clementina|type=EST|length=692bp
AACAAATCAAACAAACCCTGAAGCAGAAAGCCTGGAACTATCTTGCGGTT
TCTCCTCTCTGCCCACTGAAGACAGAAGGTGCCGGTGCCGGCTGCCGCTA
AAAATACCCACGCCACGACACAGCTGCGCCACGTTCTAGCCGCTGATAGC
CTCACGCGTCACCACGACAGGCACGAGCCGCCGACAGCCTCTGAGCCTCA
GCCCAAAACAGTCGCAGTTCTGCCGACGGCCTCACCACACGTCAGCCTCA
TCTCTCCTCTCTCAAATCAGCGTCAGTCCACAACAACCGTACCACAGCAG
CCTCAATCGACTACAGAAACCCACGACCGCAGCTCACGGCAGCAGGCCAG
CAGCCCACGAGTCCACGACAACAACCTCAGCGAACCAGCCTCAGCAAAAA
AAGCGCAGAGGGTATCCAGGAAAAGAAAAGATGGTGGTGAGGATTCGATT
GGCGAGATTCGGATGTAAGAACAAACCTTTCTATCGGGTGATGGCTGCTG
ATAGCCGATCACCCAGAGATGGTAAGCATCTTGAAGTCTTGGGCTATTAC
AACCCCTTGCCAGGTCAAGACAGCGGCAAAAGAATGGGTCTGAATTTTGA
TAGAGTGAAGTATTGGCTATCAGTTGGTGCTCAACCATCGGACCCTGTCC
AGCGCATTCTTTTCAGGGCAGGGTTGCTACCCCACCTCCTAT
back to top