BG797188
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: AGUA_ARATH (Agmatine deiminase OS=Arabidopsis thaliana GN=AIH PE=1 SV=2) HSP 1 Score: 90.8929 bits (224), Expect = 2.141e-18 Identity = 43/49 (87.76%), Postives = 45/49 (91.84%), Query Frame = 2 Query: 200 QRVFAKVATAISKFEPVTVCASAAQWENARSQLPENIRVIEMSMNDSWF 346 QRVFA VA AISKFEPVTVCAS AQWENAR QLPE+IRV+EMSMNDSWF Sbjct: 44 QRVFADVAKAISKFEPVTVCASPAQWENARKQLPEDIRVVEMSMNDSWF 92
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: TCTP_ELAGV (Translationally-controlled tumor protein homolog OS=Elaeis guineensis var. tenera GN=TCTP PE=2 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 6.230e-18 Identity = 40/45 (88.89%), Postives = 42/45 (93.33%), Query Frame = -1 Query: 15 KLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC 149 KLSDLQFFVGESMHDDGCLVFAYYK+GATDPTFLY A LKE+KC Sbjct: 124 KLSDLQFFVGESMHDDGCLVFAYYKDGATDPTFLYFAYGLKEIKC 168
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: TCTP_PSEMZ (Translationally-controlled tumor protein homolog OS=Pseudotsuga menziesii GN=TCTP PE=2 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 1.063e-17 Identity = 40/45 (88.89%), Postives = 42/45 (93.33%), Query Frame = -1 Query: 15 KLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC 149 KLSDLQFFVGESMHDDG +VFAYYK+GATDPTFLY AD LKEVKC Sbjct: 123 KLSDLQFFVGESMHDDGSMVFAYYKDGATDPTFLYFADGLKEVKC 167
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: TCTP_CUCMA (Translationally-controlled tumor protein homolog OS=Cucurbita maxima GN=TCTP PE=2 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 1.813e-17 Identity = 38/46 (82.61%), Postives = 42/46 (91.30%), Query Frame = -1 Query: 15 PKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC 152 PKL D +FFVGESMHDD C+VFAYY+EGATDPTFLY+A ALKEVKC Sbjct: 123 PKLKDFRFFVGESMHDDSCIVFAYYREGATDPTFLYLAPALKEVKC 168
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: TCTP_HEVBR (Translationally-controlled tumor protein homolog OS=Hevea brasiliensis GN=TCTP PE=2 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 1.534e-16 Identity = 40/45 (88.89%), Postives = 41/45 (91.11%), Query Frame = -1 Query: 15 KLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC 149 KLSDLQFFVGESMHDDG LVFAYY+ GATDPTFLY A ALKEVKC Sbjct: 124 KLSDLQFFVGESMHDDGSLVFAYYRGGATDPTFLYFAYALKEVKC 168
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: TCTP_MEDSA (Translationally-controlled tumor protein homolog OS=Medicago sativa GN=TCTP PE=2 SV=2) HSP 1 Score: 83.5741 bits (205), Expect = 3.418e-16 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = -1 Query: 15 KLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC 149 KL DLQFFVGESMHDDG LVFAYYK+GA DPTFLY A ALKE+KC Sbjct: 123 KLKDLQFFVGESMHDDGSLVFAYYKDGAADPTFLYFAYALKEIKC 167
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: TCTP_ORYSJ (Translationally-controlled tumor protein homolog OS=Oryza sativa subsp. japonica GN=TCTP PE=1 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 4.465e-16 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = -1 Query: 15 KLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC 149 KL DLQFFVGESMHDDG LVFAYYK+GATDPTFLY + LKEVKC Sbjct: 124 KLKDLQFFVGESMHDDGGLVFAYYKDGATDPTFLYFSHGLKEVKC 168
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: TCTP_CUCME (Translationally-controlled tumor protein homolog OS=Cucumis melo GN=TCTP PE=2 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 5.831e-16 Identity = 38/46 (82.61%), Postives = 40/46 (86.96%), Query Frame = -1 Query: 15 PKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC 152 PK+ DLQFFVGESM DD +VFAYYKEGATDPTFLYIA LKEVKC Sbjct: 123 PKVKDLQFFVGESMADDSAMVFAYYKEGATDPTFLYIAPGLKEVKC 168
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: TCTP_WHEAT (Translationally-controlled tumor protein homolog OS=Triticum aestivum GN=TCTP PE=2 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 7.616e-16 Identity = 38/45 (84.44%), Postives = 39/45 (86.67%), Query Frame = -1 Query: 15 KLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC 149 KL DLQFFVGESMHDDG +VFAYYKEGA DPTFLY A LKEVKC Sbjct: 124 KLKDLQFFVGESMHDDGGVVFAYYKEGAADPTFLYFAHGLKEVKC 168
BLAST of BG797188 vs. ExPASy Swiss-Prot
Match: TCTP_PEA (Translationally-controlled tumor protein homolog OS=Pisum sativum GN=TCTP PE=2 SV=2) HSP 1 Score: 82.4185 bits (202), Expect = 7.616e-16 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = -1 Query: 15 KLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC 149 KL DLQFFVGESMHDDG LVFAYYK+GA DPTFLY + ALKE+KC Sbjct: 123 KLKDLQFFVGESMHDDGSLVFAYYKDGAADPTFLYFSFALKEIKC 167 The following BLAST results are available for this feature:
BLAST of BG797188 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 19
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BG797188 ID=BG797188; Name=BG797188; organism=Citrus sinensis; type=EST; length=347bpback to top |