BQ622918

Overview
NameBQ622918
Unique NameBQ622918
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length485
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig701 contig Csv1_Contig701:78..562. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622918 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.807e-14
Identity = 46/101 (45.54%), Postives = 59/101 (58.42%), Query Frame = 1
Query:    1 NYPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTADGPST-VGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSWT 300
            NYPSF+V        +YTR +T+VG A + Y+V     +T V ISV P  L F+   EKK YTVTF   +  +  G  +FGSI W + +H V SPVA SWT
Sbjct:  659 NYPSFAVNVDGVGAYKYTRTVTSVGGAGT-YSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTV-DSSKPSGSNSFGSIEWSDGKHVVGSPVAISWT 757          
The following BLAST results are available for this feature:
BLAST of BQ622918 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SUBL_ARATH4.807e-1445.54Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00009 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00009 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622918 ID=BQ622918|Name=BQ622918|organism=Citrus sinensis|type=EST|length=485bp
AACTACCCATCATTCTCAGTCCTGTTTGGGGACCAGAGGGTTGTCCGTTA
CACTCGGGAGTTGACAAATGTTGGGCCTGCAAGATCCTTGTACAATGTGA
CCGCGGATGGGCCATCTACCGTTGGCATCTCAGTGAGGCCTAAAAGGCTT
CTGTTCAGGACTGTAGGAGAGAAGAAGCGATACACAGTAACATTTGTTGC
AAAGAACGGTGACCAGAAGATGGGTGGAGCTGCATTTGGTTCAATTGTTT
GGGGAAATGCTCAACATCAAGTTAGGAGCCCAGTTGCGTTTTCATGGACA
CAGTTAATGAGCTAGAAATGGTGTTTTTTCGGTTCGCGTTCTGGGTTTTC
GGGTTATGGCCCCCTGCAACGGGTTAGAAATTATTGCCAAAGGCCCTGGT
ACATCTTGGAAAACTGGGAGTTGAACAAACTTGGTGAATGGTTGTGAATT
TTATGAAGGCAGCCCAGAATTTGGAGTGGACACTG
back to top