BQ622924

Overview
NameBQ622924
Unique NameBQ622924
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622924_ssr546 microsatellite BQ622924_ssr546:546..566. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3539 contig Csv1_Contig3539:145..814. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RR9_ARATH (30S ribosomal protein S9, chloroplastic OS=Arabidopsis thaliana GN=RPS9 PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 2.989e-71
Identity = 133/144 (92.36%), Postives = 138/144 (95.83%), Query Frame = 2
Query:   50 DLKKYVKSRLPGGFAAQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +LKKYVKSRLPGGFAAQ I GTGRRKCAIARVVLQEGTGK IINYRDAKEYLQGNPLWLQY+KVPLVTLGYE SYD+FVKAHGGGLSGQAQAITLGVARALLKVS DHRSPLKKEGLLTRD+RVVERKKAGL KARKAPQ+SKR
Sbjct:   65 ELKKYVKSRLPGGFAAQKIIGTGRRKCAIARVVLQEGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYENSYDIFVKAHGGGLSGQAQAITLGVARALLKVSADHRSPLKKEGLLTRDARVVERKKAGLKKARKAPQFSKR 208          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RR9_SPIOL (30S ribosomal protein S9, chloroplastic (Fragment) OS=Spinacia oleracea GN=PRPS9 PE=1 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 2.797e-69
Identity = 127/144 (88.19%), Postives = 137/144 (95.14%), Query Frame = 2
Query:   50 DLKKYVKSRLPGGFAAQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            DL+K+VKSRLPGGFAAQT+ GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQY+K PL TLGYET+YDVFVKAHGGGLSGQAQAI+LGVARALLKVS  HR+PLK+EGLLTRDSR+VERKK GL KARKAPQ+SKR
Sbjct:   54 DLEKFVKSRLPGGFAAQTVIGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYVKTPLATLGYETNYDVFVKAHGGGLSGQAQAISLGVARALLKVSASHRAPLKQEGLLTRDSRIVERKKPGLKKARKAPQFSKR 197          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_NOSP7 (30S ribosomal protein S9 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsI PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.073e-36
Identity = 78/125 (62.40%), Postives = 91/125 (72.80%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV L  GTG+  +N +D   Y Q NP +L  IK PL TLG E  YD+ VKA GGGL+GQA ++ LGVARAL ++  D+R PLK EG LTRD R  ERKK GLHKARKAPQYSKR
Sbjct:   14 WGTGRRKNAVARVRLVPGTGQLTVNGKDGNLYFQFNPNYLGVIKAPLETLGLENEYDILVKAEGGGLTGQADSVRLGVARALCQLDPDNRPPLKTEGYLTRDPRAKERKKYGLHKARKAPQYSKR 138          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_THEEB (30S ribosomal protein S9 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsI PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.390e-36
Identity = 76/124 (61.29%), Postives = 93/124 (75.00%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  G+G+  IN R+  +YLQ NP++L  +K PL TLG E SYD++V A GGGL+GQA AI LG+ARAL ++  ++R PLK EG LTRD R  ER+K GL KARKAPQYSKR
Sbjct:   14 GTGRRKSAVARVRLIPGSGQLWINGRNGADYLQNNPIYLNLVKAPLETLGLENSYDIYVNATGGGLTGQADAIRLGIARALCQLDIENRKPLKTEGYLTRDPRAKERRKYGLRKARKAPQYSKR 137          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_SYNP2 (30S ribosomal protein S9 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpsI PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 9.083e-36
Identity = 75/125 (60.00%), Postives = 92/125 (73.60%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK +IARV L  G+GK ++N R  ++Y    P +L  +K PL TLG E+ YD+ V AHGGGL+GQA A+ LGVARAL ++  D+R PLK EG LTRD R  ERKK GLHKARKAPQ+SKR
Sbjct:   13 WGTGRRKASIARVRLVPGSGKVVVNNRSGEDYFNRIPGYLAVLKSPLETLGLESEYDILVNAHGGGLTGQADAVKLGVARALCELDPDNRQPLKIEGYLTRDPRCKERKKYGLHKARKAPQFSKR 137          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_SYNJA (30S ribosomal protein S9 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsI PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.023e-35
Identity = 79/125 (63.20%), Postives = 88/125 (70.40%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV L  GTGK IIN R   +YLQ     L  +K PL  LG E SYD+ V+AHGGG+ GQA AI LGVARAL +V   +R PLK EG L RD R VERKK GL KARKAPQYSKR
Sbjct:   13 WGTGRRKTAVARVRLVPGTGKLIINDRPGDQYLQYQEALLASVKAPLELLGLENSYDILVRAHGGGVHGQADAIKLGVARALCEVDPANRGPLKTEGYLKRDPRAVERKKYGLRKARKAPQYSKR 137          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MICAN (30S ribosomal protein S9 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsI PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.023e-35
Identity = 75/125 (60.00%), Postives = 90/125 (72.00%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+A V L  GTG   +N RD + +    P ++Q IK PL TLG E  YD+ VKA GGGL+GQA A+ LGVARAL +++ ++R PLK EG LTRD R  ERKK GLHKARKAPQYSKR
Sbjct:   13 WGTGRRKSAVAAVRLVPGTGAITVNGRDGETHFNRIPTYIQTIKAPLETLGLENEYDIIVKAEGGGLTGQADAVKLGVARALCQLAPENRPPLKSEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_CYAA5 (30S ribosomal protein S9 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsI PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.023e-35
Identity = 76/125 (60.80%), Postives = 91/125 (72.80%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV L  G+G+ I+N +    Y    P +LQ IK PL TLG E  YD+ V AHGGGL+GQA A+ LGVARAL +++ ++R PLK EG LTRD R  ERKK GLHKARKAPQYSKR
Sbjct:   13 WGTGRRKSAVARVRLVPGSGEIIVNKKPGNIYFNRIPDYLQAIKGPLETLGLENDYDILVNAHGGGLTGQADAVKLGVARALCELAPENRPPLKAEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_ANAVT (30S ribosomal protein S9 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsI PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.451e-35
Identity = 76/125 (60.80%), Postives = 90/125 (72.00%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV L  GTG+ I+N +    Y Q N  +L  IK PL TLG E  YD+ VKA GGGL+GQA ++ LGVARAL ++  ++R PLK EG LTRD R  ERKK GLHKARKAPQYSKR
Sbjct:   14 WGTGRRKSAVARVRLVPGTGQLIVNGKPGDLYFQFNANYLGVIKAPLETLGLENEYDILVKAEGGGLTGQADSVRLGVARALCQLDPENRPPLKTEGYLTRDPRAKERKKYGLHKARKAPQYSKR 138          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_ANASP (30S ribosomal protein S9 OS=Anabaena sp. (strain PCC 7120) GN=rpsI PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.451e-35
Identity = 76/125 (60.80%), Postives = 90/125 (72.00%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV L  GTG+ I+N +    Y Q N  +L  IK PL TLG E  YD+ VKA GGGL+GQA ++ LGVARAL ++  ++R PLK EG LTRD R  ERKK GLHKARKAPQYSKR
Sbjct:   14 WGTGRRKSAVARVRLVPGTGQLIVNGKPGDLYFQFNANYLGVIKAPLETLGLENEYDILVKAEGGGLTGQADSVRLGVARALCQLDPENRPPLKTEGYLTRDPRAKERKKYGLHKARKAPQYSKR 138          
The following BLAST results are available for this feature:
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RR9_ARATH2.989e-7192.3630S ribosomal protein S9, chloroplastic OS=Arabido... [more]
RR9_SPIOL2.797e-6988.1930S ribosomal protein S9, chloroplastic (Fragment)... [more]
RS9_NOSP71.073e-3662.4030S ribosomal protein S9 OS=Nostoc punctiforme (st... [more]
RS9_THEEB2.390e-3661.2930S ribosomal protein S9 OS=Thermosynechococcus el... [more]
RS9_SYNP29.083e-3660.0030S ribosomal protein S9 OS=Synechococcus sp. (str... [more]
RS9_SYNJA2.023e-3563.2030S ribosomal protein S9 OS=Synechococcus sp. (str... [more]
RS9_MICAN2.023e-3560.0030S ribosomal protein S9 OS=Microcystis aeruginosa... [more]
RS9_CYAA52.023e-3560.8030S ribosomal protein S9 OS=Cyanothece sp. (strain... [more]
RS9_ANAVT3.451e-3560.8030S ribosomal protein S9 OS=Anabaena variabilis (s... [more]
RS9_ANASP3.451e-3560.8030S ribosomal protein S9 OS=Anabaena sp. (strain P... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00015 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00015 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622924 ID=BQ622924|Name=BQ622924|organism=Citrus sinensis|type=EST|length=670bp
ACTGGTAGTATCGGCCACAGAAGCTGCGCCAGCTGAACTGGAAACAACTG
ACCTCAAGAAATACGTCAAGTCGAGGCTTCCCGGTGGCTTTGCGGCTCAA
ACTATTTTTGGAACGGGCCGTCGGAAATGCGCCATTGCTCGTGTCGTCCT
CCAAGAAGGCACCGGCAAATTCATCATCAACTACCGCGATGCCAAGGAAT
ATCTTCAAGGCAATCCACTATGGCTACAGTATATAAAAGTCCCTTTGGTA
ACTTTGGGTTATGAAACTAGCTATGATGTTTTTGTGAAAGCTCATGGTGG
CGGCCTCTCTGGTCAAGCTCAAGCAATAACACTCGGCGTTGCTCGTGCAT
TGTTGAAGGTGAGCCAGGACCATAGATCCCCTCTGAAAAAGGAAGGCCTT
CTGACTAGAGATTCCAGAGTAGTAGAGAGGAAAAAAGCTGGACTCCATAA
AGCCCGCAAAGCCCCACAGTATTCCAAACGTTGAGGCCAGAATTACAGTG
TGATGGACTGTTACCCGTAGATCTATTTTCTGCTTGTATCTCTGAATTAT
TATTATTATTATTATTTTTGGTTTAACATTTTATGTTTGGAGTTTTGTAC
TTCAGTTCCGGGTATCATGGAATCATAAACCATTTTTGATAAAAAAAACC
TAACAAAACAACTACAAAAA
back to top