BQ622927

Overview
NameBQ622927
Unique NameBQ622927
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length603
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL5_ARATH (Probable metal-nicotianamine transporter YSL5 OS=Arabidopsis thaliana GN=YSL5 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 8.155e-51
Identity = 88/119 (73.95%), Postives = 105/119 (88.24%), Query Frame = 3
Query:    6 CLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKFLSRRTNARVDKFL 362
            CL+LCY  FG AI++N+++DS+   W RFIPLPMAMAIPF+LGPYFAIDMCVGSL+LFIWE++D AKA+AFG AVASGLICGDGIWSLPSS+LA+A V PP+CMKFLS  TN++VD FL
Sbjct:  592 CLVLCYAFFGVAILVNIVKDSLHSNWGRFIPLPMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKFLSSATNSKVDNFL 710          
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL8_ARATH (Probable metal-nicotianamine transporter YSL8 OS=Arabidopsis thaliana GN=YSL8 PE=1 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 2.009e-49
Identity = 87/120 (72.50%), Postives = 104/120 (86.67%), Query Frame = 3
Query:    3 NCLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKFLSRRTNARVDKFL 362
            +CL+LCYV FG AI+INLI+D +   W RF+PLPMAMAIPF+LGPYFAIDMCVGS +LF+WE++D  KA+AF  AVASGLICGDGIW+LPSS+LA+A V+PP+CMKFLS  TN RVDKFL
Sbjct:  601 DCLMLCYVFFGVAILINLIKDCLGNRWGRFVPLPMAMAIPFFLGPYFAIDMCVGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPICMKFLSAATNHRVDKFL 720          
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL14_ORYSJ (Probable metal-nicotianamine transporter YSL14 OS=Oryza sativa subsp. japonica GN=YSL14 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 3.426e-49
Identity = 91/120 (75.83%), Postives = 105/120 (87.50%), Query Frame = 3
Query:    3 NCLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKFLSRRTNARVDKFL 362
            NCL LCY+ F AAI INLIRD    + +RFIPLPMAMAIPFY+G YFAIDM +GS++LF+WEK++KAKADAFGPAVASGLICGDGIW+LP SILALAKV+PP+CMKFLSR  NA+VD FL
Sbjct:  606 NCLTLCYIFFAAAIAINLIRDLAPHKVSRFIPLPMAMAIPFYIGSYFAIDMFLGSVILFVWEKLNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLSRAANAKVDSFL 725          
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL13_ORYSJ (Probable metal-nicotianamine transporter YSL13 OS=Oryza sativa subsp. japonica GN=YSL13 PE=2 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 5.470e-47
Identity = 85/120 (70.83%), Postives = 105/120 (87.50%), Query Frame = 3
Query:    3 NCLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKFLSRRTNARVDKFL 362
            NCL LCY  F AAIV+NLIRD + K  +RFIP+PMAMAIPFY+G YFAIDM +G+++LF+W+++D+AKAD +GPAVASG+ICGDGIW LP S+LALAKV+PP+CMKFLSRRTN +VD FL
Sbjct:  601 NCLNLCYAFFAAAIVVNLIRDLVPKV-SRFIPIPMAMAIPFYIGSYFAIDMFIGTVILFVWQRVDRAKADTYGPAVASGMICGDGIWVLPQSVLALAKVKPPICMKFLSRRTNDKVDAFL 719          
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL12_ORYSJ (Probable metal-nicotianamine transporter YSL12 OS=Oryza sativa subsp. japonica GN=YSL12 PE=2 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 5.470e-47
Identity = 87/121 (71.90%), Postives = 103/121 (85.12%), Query Frame = 3
Query:    3 NCLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKFLSRRTNARVDKFLG 365
            +CL LCY+ F AAI INL RD    + ARFIPLPMAMAIPFY+G YFAIDM +G+++LF+WE ++KAKA+AF PAVASGLICGDGIW+LP SILALAKV+PP+CMKFLSR  NA+VD FLG
Sbjct:  596 HCLTLCYIFFAAAIAINLARDLAPSKVARFIPLPMAMAIPFYIGSYFAIDMFIGTVILFVWEMVNKAKAEAFAPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLSRSVNAQVDGFLG 716          
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL7_ARATH (Probable metal-nicotianamine transporter YSL7 OS=Arabidopsis thaliana GN=YSL7 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 6.048e-46
Identity = 83/120 (69.17%), Postives = 103/120 (85.83%), Query Frame = 3
Query:    3 NCLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKFLSRRTNARVDKFL 362
            +CL+LCY+ F AA+++N IRD++  +WARFIPLPMAMAIPFYLG YF IDMC+GSL+LFIW K++K KADA+  AVASGLICG+GIW+LPSSILALA V+ P+CMKFLS  +N +VD FL
Sbjct:  566 HCLMLCYIFFAAAVIVNGIRDALGPKWARFIPLPMAMAIPFYLGGYFTIDMCLGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLPSSILALAGVKAPICMKFLSMASNNKVDAFL 685          
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL10_ORYSJ (Probable metal-nicotianamine transporter YSL10 OS=Oryza sativa subsp. japonica GN=YSL10 PE=2 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 4.792e-43
Identity = 80/120 (66.67%), Postives = 97/120 (80.83%), Query Frame = 3
Query:    3 NCLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKFLSRRTNARVDKFL 362
            +CL LC   F AAI +NL RD    + ARF+PLPMAMAIPFYLGPYF IDMC+GSL+ F+W+++D A+A AF P VASGLICGDGIW+LP S+LALA V+PP+CMKFLSR TN +VD F+
Sbjct:  561 HCLDLCIGFFVAAIAVNLARDLAAPKVARFLPLPMAMAIPFYLGPYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQSVLALAGVKPPICMKFLSRTTNIKVDAFI 680          
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL11_ORYSJ (Probable metal-nicotianamine transporter YSL11 OS=Oryza sativa subsp. japonica GN=YSL11 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 9.037e-42
Identity = 75/120 (62.50%), Postives = 98/120 (81.67%), Query Frame = 3
Query:    6 CLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKFLSRRTNARVDKFLG 365
            CL LCY+ F AA +INLI+D + +  A++IP+PMA AIPFYLGPYFAIDM +GS++L+ WE  +K +A +FGPAVASGL+CGDG+W+LP ++L+L  V PP+CMKFLSR  NA+VD FLG
Sbjct:  592 CLTLCYIAFVAAFIINLIKDLVPERVAKYIPIPMAAAIPFYLGPYFAIDMFMGSVILYFWEWRNKDEAQSFGPAVASGLMCGDGLWALPQAVLSLVNVNPPLCMKFLSRAANAKVDTFLG 711          
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL1_ARATH (Metal-nicotianamine transporter YSL1 OS=Arabidopsis thaliana GN=YSL1 PE=2 SV=2)

HSP 1 Score: 149.443 bits (376), Expect = 1.264e-35
Identity = 63/109 (57.80%), Postives = 91/109 (83.49%), Query Frame = 3
Query:    3 NCLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKFLS 329
            +CL +CY  FG A+++N++RD    +  RF+PLP AMA+PF +G YFAIDMCVG+L++F+WEK+++ KA+   PAVASGLICG+G+W+LP+++LALA V+PP+CMKFL+
Sbjct:  564 HCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYFAIDMCVGTLIVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKFLA 672          
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Match: YSL6_ORYSJ (Probable metal-nicotianamine transporter YSL6 OS=Oryza sativa subsp. japonica GN=YSL6 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.803e-35
Identity = 63/107 (58.88%), Postives = 89/107 (83.18%), Query Frame = 3
Query:    3 NCLLLCYVLFGAAIVINLIRDSIRKEWARFIPLPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKF 323
            +CL +C V F AAI+INL+RD   K  ++FIPLPMAMA+PFY+G YFAIDM VG+++LF+WE++++ +++ F  A+ASGLICGDGIWS+PS+IL++ ++ PPMCM F
Sbjct:  566 HCLAICSVFFVAAILINLLRDVTPKSVSKFIPLPMAMAVPFYIGAYFAIDMFVGTVILFVWERVNRKESEDFAGAIASGLICGDGIWSVPSAILSIMRIDPPMCMYF 672          
The following BLAST results are available for this feature:
BLAST of BQ622927 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
YSL5_ARATH8.155e-5173.95Probable metal-nicotianamine transporter YSL5 OS=A... [more]
YSL8_ARATH2.009e-4972.50Probable metal-nicotianamine transporter YSL8 OS=A... [more]
YSL14_ORYSJ3.426e-4975.83Probable metal-nicotianamine transporter YSL14 OS=... [more]
YSL13_ORYSJ5.470e-4770.83Probable metal-nicotianamine transporter YSL13 OS=... [more]
YSL12_ORYSJ5.470e-4771.90Probable metal-nicotianamine transporter YSL12 OS=... [more]
YSL7_ARATH6.048e-4669.17Probable metal-nicotianamine transporter YSL7 OS=A... [more]
YSL10_ORYSJ4.792e-4366.67Probable metal-nicotianamine transporter YSL10 OS=... [more]
YSL11_ORYSJ9.037e-4262.50Probable metal-nicotianamine transporter YSL11 OS=... [more]
YSL1_ARATH1.264e-3557.80Metal-nicotianamine transporter YSL1 OS=Arabidopsi... [more]
YSL6_ORYSJ4.803e-3558.88Probable metal-nicotianamine transporter YSL6 OS=O... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00018 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00018 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622927 ID=BQ622927|Name=BQ622927|organism=Citrus sinensis|type=EST|length=603bp
AGAATTGTCTCTTGCTTTGCTATGTGCTTTTCGGAGCAGCCATTGTGATA
AATCTGATTAGGGATTCAATACGCAAGGAGTGGGCAAGGTTCATTCCTCT
CCCAATGGCAATGGCAATTCCTTTTTACTTGGGGCCGTACTTTGCCATTG
ATATGTGTGTTGGAAGCCTGCTTTTGTTCATCTGGGAAAAGATAGACAAG
GCAAAAGCAGATGCTTTTGGTCCAGCAGTTGCTTCCGGTTTGATTTGTGG
CGATGGAATATGGAGTTTGCCCAGTTCCATACTTGCTCTAGCAAAGGTCC
AGCCGCCCATGTGCATGAAGTTTTTGTCAAGGAGAACCAATGCCAGGGTT
GATAAATTCTTAGGATTTTAATTTTCAGCCCTCGATGAATCCAGTTGAAG
TTCCACCATGCGCTTATCGTTGTTGAAGCATCCTCAACTTGTAAAATACC
GCTTCTTTTTACTTCTTTTCCACTTTTTCCTCGTGTGAAGTAGGATAGCT
TGTTTGTGCTGAAGTATATTATTGTACTGTAAAATCAGGTATAAACTCAT
GCTTTGGTTTGAATCCTGTACTGGCATAGAAAGTGAAAGGAAATGTCCAA
GCT
back to top