BQ622931

Overview
NameBQ622931
Unique NameBQ622931
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length523
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3_KLULA (Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis GN=SUP35 PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.667e-35
Identity = 73/154 (47.40%), Postives = 104/154 (67.53%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCD-DNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL 461
            W+ GP L E LD ++ T R  N PF +PI  K KDMGTVV GK+ESG +R+G+  L+MPN+  V++L IY + ++ V  A  GE +R+R+ G+EEE+I +GFVL+S   PV  VT F+AQ+ I+EL   +I +AG+  V+HIH  +EE  +  L
Sbjct:  480 WYTGPSLLEYLDNMKTTDRHINAPFMLPIASKMKDMGTVVEGKIESGHIRKGNQTLLMPNRTSVEILTIYNETESEVDMAVCGEQVRLRIKGVEEEEISAGFVLTSPKNPVKNVTRFVAQIAIVEL--KSIMSAGFSCVMHIHTAIEEVTVTRL 631          
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3_PICPI (Eukaryotic peptide chain release factor GTP-binding subunit OS=Pichia pinus GN=SUP2 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 7.758e-35
Identity = 78/175 (44.57%), Postives = 109/175 (62.29%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCD-DNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL------ATSNRSEDQETHEKE 506
            W+NGP L E LD + +  R  N PF +PI  K KD+GTV+ GK+ESG V++G +LLVMPNK QV+V  IY + +     A  GE +R+RL GIEEED+ +G+VLSS+  PV  VT F AQ+ I+EL   +I + G+  V+H+H  +EE    +L       T+ RS+      K+
Sbjct:  523 WYNGPSLLEYLDSMPLAVRKINDPFMLPISSKMKDLGTVIEGKIESGHVKKGQNLLVMPNKTQVEVTTIYNETEAEADSAFCGEQVRLRLRGIEEEDLSAGYVLSSINHPVKTVTRFEAQIAIVEL--KSILSTGFSCVMHVHTAIEEVTFTQLLHNLQKGTNRRSKKAPAFAKQ 695          
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3_YEAST (Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae GN=SUP35 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 2.948e-34
Identity = 71/154 (46.10%), Postives = 103/154 (66.88%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCD-DNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL 461
            W+ GP L E LD +    R  N PF +PI  K KD+GT+V GK+ESG +++G S L+MPNK  V++  IY + +N V  A  GE +++R+ G+EEEDI  GFVL+S   P+ +VT+F+AQ+ I+EL   +I  AG+  V+H+H  +EE  IV+L
Sbjct:  466 WYTGPTLLEYLDTMNHVDRHINAPFMLPIAAKMKDLGTIVEGKIESGHIKKGQSTLLMPNKTAVEIQNIYNETENEVDMAMCGEQVKLRIKGVEEEDISPGFVLTSPKNPIKSVTKFVAQIAIVEL--KSIIAAGFSCVMHVHTAIEEVHIVKL 617          
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3_CANMA (Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 6.568e-34
Identity = 71/154 (46.10%), Postives = 103/154 (66.88%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCD-DNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL 461
            W+ GP L E LD ++   R  NGPF MP+  K KD+GTVV GK+ESG V++G +L++MPNK  V+VL IY + +     A  GE +R+++ G+EEED+  G+VL+S   PV  VT+F AQ+ I+EL   +I + G+  V+H+H  +EE + VEL
Sbjct:  494 WYEGPSLLEYLDNMDTMNRKINGPFMMPVSGKMKDLGTVVEGKIESGHVKKGTNLILMPNKTPVEVLTIYNETEQEADTAFSGEQVRLKIKGVEEEDLQPGYVLTSPKNPVKTVTKFEAQIAIVEL--KSILSNGFSCVMHLHTAIEEVKFVEL 645          
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3_DEBHA (Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii GN=SUP35 PE=3 SV=4)

HSP 1 Score: 142.895 bits (359), Expect = 8.578e-34
Identity = 67/154 (43.51%), Postives = 105/154 (68.18%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCD-DNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL 461
            W++GP L E LD ++   R  NGPF +PI  K KDMGT++ GK+ESG +++G +LL+MPNKA ++V+AI+ + +     A  GE +R+++ G+EEED+  G+VL+S  KP+  +T F AQ+ I+EL   +I + G+  V+H+H  +EE   +EL
Sbjct:  483 WYSGPSLLEFLDNMKTMQRHINGPFMLPISGKMKDMGTIIEGKIESGHIKKGGNLLLMPNKASIEVVAIFNETEQECDAAFCGEQVRLKIKGVEEEDLAPGYVLTSPLKPIKTITRFEAQIAIVEL--KSILSNGFSCVMHLHTAIEEVTFIEL 634          
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3_ZYGRO (Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 4.257e-33
Identity = 69/154 (44.81%), Postives = 102/154 (66.23%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCD-DNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL 461
            W++GP L E +D +    R  N PF +PI  K +DMGT+V GK+ESG +R+G S L+MPNK  V++  IY + +N V  A  GE +++++ G+EEEDI  GFVL+S   PV  VT F+AQ+ I+EL   +I ++G+  V+H+H  +EE  I +L
Sbjct:  443 WYDGPALLEYMDNMSHVDRKMNAPFMLPIAAKMRDMGTIVEGKIESGHIRKGHSTLLMPNKIPVEIQNIYNETENEVDMAICGEQVKLKIKGVEEEDIAPGFVLTSPKNPVKNVTRFVAQVAIVEL--KSILSSGFSCVMHVHTAIEEVRITKL 594          
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3_CANAL (Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 4.257e-33
Identity = 68/154 (44.16%), Postives = 103/154 (66.88%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCD-DNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL 461
            W++GP L E LD ++   R  NGPF MP+  K KD+GT+V GK+ESG V++G +L++MPNK  ++VL I+ + +     A  GE +R+++ GIEEED+  G+VL+S   PV  VT F AQ+ I+EL   +I + G+  V+H+H  +EE + +EL
Sbjct:  497 WYDGPSLLEYLDNMDTMNRKINGPFMMPVSGKMKDLGTIVEGKIESGHVKKGTNLIMMPNKTPIEVLTIFNETEQECDTAFSGEQVRLKIKGIEEEDLQPGYVLTSPKNPVKTVTRFEAQIAIVEL--KSILSNGFSCVMHLHTAIEEVKFIEL 648          
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3B_PONAB (Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Pongo abelii GN=GSPT2 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 7.262e-33
Identity = 73/153 (47.71%), Postives = 95/153 (62.09%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL 461
            W+ G      LD +    R  +GP R+PI+DK+KDMGTVV+GK+ESGS+ +G  L++MPNK  V+VL I  DD       PGENL+IRL GIEEE+IL GF+L   +    +   F  Q+ I+E    +I   GY AVLHIH  +EE EI  L
Sbjct:  407 WYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGENLKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVIIE--HKSIICPGYNAVLHIHTCIEEVEITAL 557          
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3B_HUMAN (Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 7.262e-33
Identity = 73/153 (47.71%), Postives = 95/153 (62.09%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL 461
            W+ G      LD +    R  +GP R+PI+DK+KDMGTVV+GK+ESGS+ +G  L++MPNK  V+VL I  DD       PGENL+IRL GIEEE+IL GF+L   +    +   F  Q+ I+E    +I   GY AVLHIH  +EE EI  L
Sbjct:  407 WYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGENLKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVIIE--HKSIICPGYNAVLHIHTCIEEVEITAL 557          
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Match: ERF3A_MOUSE (Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 9.484e-33
Identity = 74/153 (48.37%), Postives = 96/153 (62.75%), Query Frame = 3
Query:    3 WWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVEL 461
            W+ G      LD +    R  +GP R+PI+DK+KDMGTVV+GK+ESGS+ +G  L++MPNK  V+VL I  DD       PGENL+IRL GIEEE+IL GF+L  +     +   F AQ+ I+E    +I   GY AVLHIH  +EE EI  L
Sbjct:  278 WYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDSVAPGENLKIRLKGIEEEEILPGFILCDLNNLCHSGRTFDAQIVIIE--HKSIICPGYNAVLHIHTCIEEVEITAL 428          
The following BLAST results are available for this feature:
BLAST of BQ622931 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ERF3_KLULA2.667e-3547.40Eukaryotic peptide chain release factor GTP-bindin... [more]
ERF3_PICPI7.758e-3544.57Eukaryotic peptide chain release factor GTP-bindin... [more]
ERF3_YEAST2.948e-3446.10Eukaryotic peptide chain release factor GTP-bindin... [more]
ERF3_CANMA6.568e-3446.10Eukaryotic peptide chain release factor GTP-bindin... [more]
ERF3_DEBHA8.578e-3443.51Eukaryotic peptide chain release factor GTP-bindin... [more]
ERF3_ZYGRO4.257e-3344.81Eukaryotic peptide chain release factor GTP-bindin... [more]
ERF3_CANAL4.257e-3344.16Eukaryotic peptide chain release factor GTP-bindin... [more]
ERF3B_PONAB7.262e-3347.71Eukaryotic peptide chain release factor GTP-bindin... [more]
ERF3B_HUMAN7.262e-3347.71Eukaryotic peptide chain release factor GTP-bindin... [more]
ERF3A_MOUSE9.484e-3348.37Eukaryotic peptide chain release factor GTP-bindin... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00022 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00022 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622931 ID=BQ622931|Name=BQ622931|organism=Citrus sinensis|type=EST|length=523bp
CATGGTGGAATGGCCCCTGTCTTTTTGAAGCCCTTGATCGTATTGAGATA
ACTCCTCGAGATCCTAATGGTCCATTTAGGATGCCTATAATTGACAAATT
CAAGGACATGGGAACTGTTGTTATGGGGAAGGTGGAATCTGGTAGTGTAC
GGGAGGGGGATTCCTTGTTGGTCATGCCAAACAAGGCTCAAGTTAAAGTT
CTGGCCATATACTGTGATGACAATAGGGTTAGGCATGCAGGACCCGGTGA
AAATCTACGGATCAGATTATCTGGAATTGAAGAGGAAGATATACTATCTG
GTTTTGTCTTGTCAAGTGTTGCAAAACCAGTAGCCGCAGTCACTGAATTT
ATTGCCCAGTTGCAGATTCTTGAGTTGCTGGACAATGCAATTTTTACGGC
CGGCTACAAGGCTGTTTTACACATTCATGCTGTTGTCGAGGAATGTGAGA
TTGTTGAACTTGCTACATCAAATCGATCTGAAGACCAAGAAACCCATGAA
AAAGAAAGTTCTCTTTGGTAAGA
back to top