BQ622932

Overview
NameBQ622932
Unique NameBQ622932
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length570
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622932_ssr237 microsatellite BQ622932_ssr237:237..248. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBP2_CASGL (Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.295e-15
Identity = 42/50 (84.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            S VQLRKAGK+TVRES+LKKLGA HFK GV +EHFE TKFALLETIKEAV
Sbjct:   80 SAVQLRKAGKVTVRESSLKKLGASHFKHGVADEHFEVTKFALLETIKEAV 129          
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBL1_GOSHI (Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum GN=HB1 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.885e-15
Identity = 42/50 (84.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            S VQLRKAGK+TVRES LKKLGA HFK GV +EHFE TKFALLETIKEAV
Sbjct:   80 SAVQLRKAGKVTVRESNLKKLGATHFKYGVVDEHFEVTKFALLETIKEAV 129          
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBPL_PARRI (Non-legume hemoglobin OS=Parasponia rigida PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 6.427e-15
Identity = 39/50 (78.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            S VQLRKAGK TV+ES LK++GA+HFK+GV NEHFE T+FALLETIKEAV
Sbjct:   81 SAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAV 130          
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBPL_PARAD (Non-legume hemoglobin OS=Parasponia andersonii PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 6.427e-15
Identity = 39/50 (78.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            S VQLRKAGK TV+ES LK++GA+HFK+GV NEHFE T+FALLETIKEAV
Sbjct:   81 SAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAV 130          
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBL_TRETO (Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB1 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 8.394e-15
Identity = 41/50 (82.00%), Postives = 46/50 (92.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            S VQLRKAGK+TVRES LK+LGA+HFK+GV NEHFE T+FALLETIKEAV
Sbjct:   81 SAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFE-TRFALLETIKEAV 129          
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBL1_MEDSA (Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=MHB1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.096e-14
Identity = 41/50 (82.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            S VQLRK+GK+TVRES+LKKLGA HFK GV +EHFE TKFALLETIKEAV
Sbjct:   80 SAVQLRKSGKVTVRESSLKKLGANHFKYGVVDEHFEVTKFALLETIKEAV 129          
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBL2_ORYSJ (Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. japonica GN=HB2 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.441e-14
Identity = 37/50 (74.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            +  QLRKAGK+TVR++TLK+LGA HFK GVG+ HFE T+FALLETIKEAV
Sbjct:   88 AAAQLRKAGKVTVRDTTLKRLGATHFKYGVGDAHFEVTRFALLETIKEAV 137          
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBL1_ARATH (Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana GN=AHB1 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.340e-12
Identity = 37/50 (74.00%), Postives = 42/50 (84.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            S VQLRK GK+TVRE+TLK+LGA H K GV +EHFE  K+ALLETIKEAV
Sbjct:   80 SAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAV 129          
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBL1_ORYSJ (Non-symbiotic hemoglobin 1 OS=Oryza sativa subsp. japonica GN=HB1 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.899e-12
Identity = 34/50 (68.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            +  QLRKAGK+TVR++TLK+LGA H K GVG+ HFE  KFALL+TIKE V
Sbjct:   85 AAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEV 134          
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Match: HBL_HORVU (Non-symbiotic hemoglobin OS=Hordeum vulgare GN=HB PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.092e-12
Identity = 34/50 (68.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:  402 STVQLRKAGKMTVRESTLKKLGAVHFKSGVGNEHFEGTKFALLETIKEAV 551
            +  QLRKAGK+TVRE+TLK+LG  H K GV + HFE T+FALLETIKEA+
Sbjct:   81 AAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHFEVTRFALLETIKEAL 130          
The following BLAST results are available for this feature:
BLAST of BQ622932 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
HBP2_CASGL1.295e-1584.00Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1[more]
HBL1_GOSHI2.885e-1584.00Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum G... [more]
HBPL_PARRI6.427e-1578.00Non-legume hemoglobin OS=Parasponia rigida PE=1 SV... [more]
HBPL_PARAD6.427e-1578.00Non-legume hemoglobin OS=Parasponia andersonii PE=... [more]
HBL_TRETO8.394e-1582.00Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB... [more]
HBL1_MEDSA1.096e-1482.00Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=M... [more]
HBL2_ORYSJ5.441e-1474.00Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. ... [more]
HBL1_ARATH1.340e-1274.00Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana... [more]
HBL1_ORYSJ3.899e-1268.00Non-symbiotic hemoglobin 1 OS=Oryza sativa subsp. ... [more]
HBL_HORVU5.092e-1268.00Non-symbiotic hemoglobin OS=Hordeum vulgare GN=HB ... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00023 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00023 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622932 ID=BQ622932|Name=BQ622932|organism=Citrus sinensis|type=EST|length=570bp
TGGCCACCGCCGCCCGCAGCTCTAGTTTTTTTTTTAATTTGTTCTTCAAA
TCTTTTTCCAAAACCTAAATCCGGCCAAGACGTGGCAATGGAAACAATAA
AAGAAACAGTTGAAACAGAGAATGAGATACGCTTGATTAGACGAAGAGGA
AGAGAAAGAAGCGTCACCATATGAGAACAGCAACGGCGGTGGGCCATCCT
CGTCTTCTTCATCCATGCCGACTTTAGCCACAATCAAAGAAGAAGAAGAA
AAAGAGGAAGGCGCTGTTGATGATGAACTTGTCGGTGGCGGATCGTTGCC
AAAGCCAATGGAAGGATTAAACGAGGTGGGTCTACCGCCGTTTTTGAGGA
AAATATATGAGATGGTGGAGGATCTGGAAACCGAACCGGTTGTTTCTTGG
ATCAACAGTGCAACTGAGGAAAGCAGGAAAAATGACAGTAAGAGAATCAA
CTCTAAAGAAATTAGGAGCTGTCCACTTCAAATCTGGTGTTGGTAATGAA
CATTTTGAGGGCACAAAATTTGCACTACTGGAAACAATAAAGGAAGCAGT
CCAGAGATATGGGCACCAAA
back to top