BQ622940

Overview
NameBQ622940
Unique NameBQ622940
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length594
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7725 contig Csv1_Contig7725:667..1260. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO_TOBAC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Nicotiana tabacum GN=PSBO PE=2 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.804e-71
Identity = 132/140 (94.29%), Postives = 137/140 (97.86%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 422
            GIDYAAVTVQL GGERVPFLFTIKQLVASGKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNTSSSTGKITLSVT+SKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE
Sbjct:  193 GIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTSSSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 332          
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO_SOLLC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum lycopersicum GN=PSBO PE=2 SV=2)

HSP 1 Score: 265.003 bits (676), Expect = 1.995e-70
Identity = 130/140 (92.86%), Postives = 136/140 (97.14%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 422
            GIDYAAVTVQL GGERVPFLFTIKQLVASGKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNT+S TGKITLSVT+SKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE
Sbjct:  190 GIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 329          
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO_FRIAG (Oxygen-evolving enhancer protein 1, chloroplastic OS=Fritillaria agrestis GN=PSBO PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 3.184e-68
Identity = 125/140 (89.29%), Postives = 133/140 (95.00%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 422
            GIDYAAVTVQL GGERVPFLFT+KQLVA+GKPE+F G +LVPSYRGSSFLDPKGRGGS GYDNA+ALPAGGRGDEE+L KENIK+ SSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLG+K PKDVKIQGIWYAQLE
Sbjct:  190 GIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGSYLVPSYRGSSFLDPKGRGGSAGYDNAVALPAGGRGDEEELVKENIKDVSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGSKAPKDVKIQGIWYAQLE 329          
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO_SPIOL (Oxygen-evolving enhancer protein 1, chloroplastic OS=Spinacia oleracea GN=PSBO PE=1 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 1.580e-67
Identity = 124/141 (87.94%), Postives = 133/141 (94.33%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLEQ 425
            GIDYAAVTVQL GGERVPFLFTIKQLVASGKPE+F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN KN +SS G ITLSVT SKPETGEVIGVF+S+QPSDTDLGAKVPKDVKI+G+WYAQLEQ
Sbjct:  191 GIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLEQ 331          
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO2_ARATH (Oxygen-evolving enhancer protein 1-2, chloroplastic OS=Arabidopsis thaliana GN=PSBO2 PE=1 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 1.580e-67
Identity = 120/140 (85.71%), Postives = 134/140 (95.71%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 422
            GIDYAAVTVQL GGERVPFLFT+KQL ASGKPE+F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L+KEN+KNT++S G+ITL +TKSKPETGEVIGVFES+QPSDTDLGAKVPKDVKIQG+WY Q+E
Sbjct:  192 GIDYAAVTVQLPGGERVPFLFTVKQLEASGKPESFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE 331          
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO_SOLTU (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum tuberosum GN=PSBO PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 2.696e-67
Identity = 124/140 (88.57%), Postives = 132/140 (94.29%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 422
            GIDYAAVTVQL GGERVPFLFTIKQLVASGKPE+F  +FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNT+S TGKIT +VTKS P+TGEVIGVFESIQPSDTDLGAK PKDVKIQGIWYAQLE
Sbjct:  193 GIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSVDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE 332          
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO1_ARATH (Oxygen-evolving enhancer protein 1-1, chloroplastic OS=Arabidopsis thaliana GN=PSBO1 PE=1 SV=2)

HSP 1 Score: 253.832 bits (647), Expect = 4.598e-67
Identity = 121/140 (86.43%), Postives = 133/140 (95.00%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 422
            GIDYAAVTVQL GGERVPFLFT+KQL ASGKP++F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNT++S G+ITL VTKSKPETGEVIGVFES+QPSDTDLGAKVPKDVKIQG+WY QLE
Sbjct:  193 GIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE 332          
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO_PEA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Pisum sativum GN=PSBO PE=2 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 1.024e-66
Identity = 123/140 (87.86%), Postives = 132/140 (94.29%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 422
            GIDYAAVTVQL GGERVPFLFTIKQLVASGKP++F GEFLVPSYRGSSFLDPKGRG STGYDNA+ALPAGGRGDEE+L KEN K+ +SS GKITLSVT++KPETGEVIGVFESIQPSDTDLGAK PKDVKIQG+WYAQLE
Sbjct:  189 GIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE 328          
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO_WHEAT (Oxygen-evolving enhancer protein 1, chloroplastic OS=Triticum aestivum GN=PSBO PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 7.597e-62
Identity = 121/140 (86.43%), Postives = 128/140 (91.43%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 422
            GIDYAAVTVQL GGERV FLFT+KQLVA+GKPE+F   FLVPSYRGSSFLDPKGRGGSTGYDNA ALP GGRGDEE+LAKEN+KN SSSTG ITLSVTKSKPETGEVIGVFES+QPSDTDL A  PKDVKIQG+WYAQLE
Sbjct:  187 GIDYAAVTVQLPGGERVAFLFTVKQLVATGKPESFR-PFLVPSYRGSSFLDPKGRGGSTGYDNAGALPRGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLEA--PKDVKIQGVWYAQLE 323          
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Match: PSBO_EUGGR (Oxygen-evolving enhancer protein 1, chloroplastic OS=Euglena gracilis GN=PSBO PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 8.712e-50
Identity = 95/139 (68.35%), Postives = 112/139 (80.58%), Query Frame = 3
Query:    3 GIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQL 419
            G+DYAA TVQLAGGERVPFLFTIK L+A G    F G+F VPSYRG++FLDPKGRGG++GYD A+ALPA   GD+E+ AKEN K+T++S G I   V K   ETGE+ GVFESIQPSDTDLGAKVPKD+K  G+WYAQ+
Sbjct:  198 GLDYAATTVQLAGGERVPFLFTIKNLLAKGDAGQFLGQFDVPSYRGATFLDPKGRGGASGYDTAVALPAS--GDDEEYAKENSKSTAASVGTIAFKVAKVNAETGEIAGVFESIQPSDTDLGAKVPKDIKTSGVWYAQI 334          
The following BLAST results are available for this feature:
BLAST of BQ622940 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
PSBO_TOBAC1.804e-7194.29Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SOLLC1.995e-7092.86Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_FRIAG3.184e-6889.29Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SPIOL1.580e-6787.94Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO2_ARATH1.580e-6785.71Oxygen-evolving enhancer protein 1-2, chloroplasti... [more]
PSBO_SOLTU2.696e-6788.57Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO1_ARATH4.598e-6786.43Oxygen-evolving enhancer protein 1-1, chloroplasti... [more]
PSBO_PEA1.024e-6687.86Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_WHEAT7.597e-6286.43Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_EUGGR8.712e-5068.35Oxygen-evolving enhancer protein 1, chloroplastic ... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00031 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00031 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622940 ID=BQ622940|Name=BQ622940|organism=Citrus sinensis|type=EST|length=594bp
ATGGAATTGACTATGCTGCTGTGACAGTTCAGCTGGCTGGAGGCGAGCGT
GTGCCCTTCCTTTTCACCATCAAACAATTGGTAGCATCAGGCAAACCTGA
GAATTTCGGAGGAGAATTCCTGGTACCATCTTACCGTGGATCATCCTTCT
TGGACCCAAAGGGAAGGGGTGGTTCAACTGGTTATGACAATGCTATTGCA
TTGCCTGCCGGTGGAAGAGGGGACGAGGAAGATCTCGCCAAGGAGAATAT
CAAGAATACTTCATCTTCAACAGGGAAGATCACCCTCAGCGTTACCAAGA
GCAAGCCTGAGACCGGAGAGGTTATTGGAGTGTTTGAGAGCATTCAGCCA
TCTGATACTGATTTGGGAGCCAAGGTTCCAAAGGATGTTAAGATCCAGGG
TATCTGGTATGCACAGCTTGAGCAATAGAGCTTTTCTTGTATGAGTGTAC
TTATTCCTATTCAGATTTTGAAACATGTTGAAGGTGTTGCTAAACATTTC
TGTAATTCAATTTAGTAGCACTGAGAATGGTATCACGTCTGTATATTATC
ATGGCATGCTATAATAATGCTTGCAATTCAAAACAAAAAAAAAA
back to top