BQ622949

Overview
NameBQ622949
Unique NameBQ622949
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length467
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig444 contig Csv1_Contig444:71..537. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS_SOLLC (Plastocyanin, chloroplastic OS=Solanum lycopersicum GN=PETE PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 1.304e-42
Identity = 88/139 (63.31%), Postives = 106/139 (76.26%), Query Frame = 2
Query:   56 GLKAGATPARVV--GSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            GLKAGA+ +  V  G++ K +A+ V +L++KA+LKDVG                  +EVLLGGDDGSLAF+P +FSVS+GEKI FKNNAGFPHNVVFDEDEIP+GVD SKISMS EDLLN  GETY+VTL+EKGTY+FY
Sbjct:   16 GLKAGASSSSRVSTGASAKVAAAPVARLTVKASLKDVGAVVAATAVSAMLASNAMALEVLLGGDDGSLAFIPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDASKISMSEEDLLNAAGETYSVTLSEKGTYTFY 154          
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS1_POPNI (Plastocyanin A, chloroplastic OS=Populus nigra GN=PETE PE=1 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 1.883e-41
Identity = 86/137 (62.77%), Postives = 98/137 (71.53%), Query Frame = 2
Query:   56 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            GLKAG+     V ++ K SAS +P+LSIKA++KDVG                  I+VLLG DDGSLAFVPS FS+S GEKIVFKNNAGFPHN+VFDED IPSGVD SKISMS EDLLN  GET+ V L+ KG YSFY
Sbjct:   16 GLKAGSASNAKVSASAKVSASPLPRLSIKASMKDVGAAVVATAASAMIASNAMAIDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFY 152          
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS_SPIOL (Plastocyanin, chloroplastic OS=Spinacia oleracea GN=PETE PE=1 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 7.155e-41
Identity = 88/141 (62.41%), Postives = 102/141 (72.34%), Query Frame = 2
Query:   56 GLKAGA----TPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            GLKA      T A+++ +T     +AVP+LS+KA+LK+VG                  +EVLLGG DGSLAF+P  FSV+SGE+IVFKNNAGFPHNVVFDEDEIPSGVD +KISMS EDLLN PGETY VTLTEKGTY FY
Sbjct:   17 GLKASGSIKPTTAKIIPTT-----TAVPRLSVKASLKNVGAAVVATAAAGLLAGNAMAVEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFY 152          
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS2_POPNI (Plastocyanin B, chloroplastic OS=Populus nigra GN=PETE PE=1 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 4.638e-40
Identity = 83/137 (60.58%), Postives = 99/137 (72.26%), Query Frame = 2
Query:   56 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            GLKA +     V ++ K SAS +P+LSIKA+LK+VG                  ++VLLG DDGSLAFVPS FSV +GEKIVFKNNAGFPHNV+FDED +PSGVDVSKISMS EDLLN  GET+ V L++KG Y+FY
Sbjct:   16 GLKAASASNAKVSASAKVSASPLPRLSIKASLKEVGAAVVATAASAMIASNAMAVDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFY 152          
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS_SILPR (Plastocyanin, chloroplastic OS=Silene pratensis GN=PETE PE=1 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.492e-38
Identity = 84/137 (61.31%), Postives = 96/137 (70.07%), Query Frame = 2
Query:   56 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            GLKA +T      +T+K  A A P++SIKA+LKDVG                   EVLLG  DG LAFVPS  S++SGEKI FKNNAGFPHNVVFDEDE+P+GVDV+KISM  EDLLN PGE Y+VTLTEKGTY FY
Sbjct:   17 GLKASSTTR---AATVKV-AVATPRMSIKASLKDVGVVVAATAAAGILAGNAMAAEVLLGSSDGGLAFVPSDLSIASGEKITFKNNAGFPHNVVFDEDEVPAGVDVTKISMPEEDLLNAPGEEYSVTLTEKGTYKFY 149          
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS2_ARATH (Plastocyanin major isoform, chloroplastic OS=Arabidopsis thaliana GN=DRT112 PE=1 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 1.263e-37
Identity = 80/137 (58.39%), Postives = 96/137 (70.07%), Query Frame = 2
Query:   56 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            GLKA    +      ++ +A A PKL++K++LK+ G                  IEVLLGG DGSLAF+P+ FS++ GEKIVFKNNAG+PHNVVFDEDEIPSGVDV+KISM  +DLLNG GETY V LTE GTYSFY
Sbjct:   16 GLKASTIKSSAT-VRIQTAAVASPKLTVKSSLKNFGVAAVAAAASIALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDVAKISMDEQDLLNGAGETYEVALTEPGTYSFY 151          
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS1_ARATH (Plastocyanin minor isoform, chloroplastic OS=Arabidopsis thaliana GN=PETE PE=2 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 4.799e-37
Identity = 83/140 (59.29%), Postives = 93/140 (66.43%), Query Frame = 2
Query:   56 GLKAGATPARVVGSTMKASASAV---PKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            GLK   +      ST+  S SA    PKL++K++LKD G                  +EVLLG DDGSLAFVPS F+V+ GEKIVFKNNAGFPHNVVFDEDEIPSGVD SKISM    LLNG GETY VTLTE G+Y FY
Sbjct:   16 GLKLAVSSKPKTLSTISRSTSATRAPPKLALKSSLKDFGVIAVATAASIVLAGNAMAMEVLLGSDDGSLAFVPSEFTVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDASKISMDETALLNGAGETYEVTLTEPGSYGFY 155          
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS_PEA (Plastocyanin, chloroplastic OS=Pisum sativum GN=PETE PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 5.306e-36
Identity = 78/137 (56.93%), Postives = 88/137 (64.23%), Query Frame = 2
Query:   56 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            GLK  A       + +  S S  P+L ++A+LKD G                  +EVLLG  DG LAFVPSS  VS+GE IVFKNNAGFPHNVVFDEDEIP+GVD SKISM  EDLLN PGETY+V L  KGTY FY
Sbjct:   16 GLKTNAATKVSAMAKIPTSTSQSPRLCVRASLKDFGVALVATAASAVLASNALAVEVLLGASDGGLAFVPSSLEVSAGETIVFKNNAGFPHNVVFDEDEIPAGVDASKISMPEEDLLNAPGETYSVKLDAKGTYKFY 152          
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS2_TOBAC (Plastocyanin B'/B'' OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 5.306e-36
Identity = 71/83 (85.54%), Postives = 77/83 (92.77%), Query Frame = 2
Query:  218 IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            IEVLLG DDG LAFVP +FSVS+GEKI FKNNAGFPHNVVFDEDEIP+GVD SKISMS EDLLNGPGETY+VTL+EKGTY+FY
Sbjct:    1 IEVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDASKISMSEEDLLNGPGETYSVTLSEKGTYTFY 83          
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Match: PLAS_RUMOB (Plastocyanin OS=Rumex obtusifolius GN=PETE PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 6.930e-36
Identity = 69/83 (83.13%), Postives = 78/83 (93.98%), Query Frame = 2
Query:  218 IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFY 466
            IE+ LGGDDG+LAFVP SF+V++GEKIVFKNNAGFPHN+VFDEDE+P+GVD SKISMS EDLLN PGETYAVTL+EKGTYSFY
Sbjct:    1 IEIKLGGDDGALAFVPGSFTVAAGEKIVFKNNAGFPHNIVFDEDEVPAGVDASKISMSEEDLLNAPGETYAVTLSEKGTYSFY 83          
The following BLAST results are available for this feature:
BLAST of BQ622949 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
PLAS_SOLLC1.304e-4263.31Plastocyanin, chloroplastic OS=Solanum lycopersicu... [more]
PLAS1_POPNI1.883e-4162.77Plastocyanin A, chloroplastic OS=Populus nigra GN=... [more]
PLAS_SPIOL7.155e-4162.41Plastocyanin, chloroplastic OS=Spinacia oleracea G... [more]
PLAS2_POPNI4.638e-4060.58Plastocyanin B, chloroplastic OS=Populus nigra GN=... [more]
PLAS_SILPR1.492e-3861.31Plastocyanin, chloroplastic OS=Silene pratensis GN... [more]
PLAS2_ARATH1.263e-3758.39Plastocyanin major isoform, chloroplastic OS=Arabi... [more]
PLAS1_ARATH4.799e-3759.29Plastocyanin minor isoform, chloroplastic OS=Arabi... [more]
PLAS_PEA5.306e-3656.93Plastocyanin, chloroplastic OS=Pisum sativum GN=PE... [more]
PLAS2_TOBAC5.306e-3685.54Plastocyanin B'/B'' OS=Nicotiana tabacum PE=1 SV=1[more]
PLAS_RUMOB6.930e-3683.13Plastocyanin OS=Rumex obtusifolius GN=PETE PE=1 SV... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00040 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00040 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622949 ID=BQ622949|Name=BQ622949|organism=Citrus sinensis|type=EST|length=467bp
TACAGTTACAATGGCTACTGTCACCTCTGCAGCTGTCACCGTCCCAACTT
TCACCGGCCTTAAAGCCGGTGCAACACCAGCCAGAGTTGTTGGTTCCACC
ATGAAGGCCTCAGCCTCTGCTGTCCCAAAGCTCAGCATCAAGGCCACACT
CAAAGATGTTGGAGTGGCCGTTGCGGCCACAGCTGCCAGCGCAATGCTTG
CTAGCAATGCCATGGCCATTGAGGTTTTGCTTGGTGGTGATGATGGGTCC
TTGGCTTTTGTTCCAAGCTCTTTCTCTGTCAGCTCCGGTGAAAAGATTGT
GTTCAAGAACAATGCTGGGTTCCCACACAACGTTGTTTTCGATGAAGATG
AGATTCCGAGTGGTGTTGATGTTTCAAAAATCTCCATGTCTACAGAAGAC
CTTCTCAATGGTCCTGGAGAGACTTATGCTGTTACTCTGACTGAAAAAGG
CACTTACTCTTTTTACT
back to top