BQ622993

Overview
NameBQ622993
Unique NameBQ622993
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length638
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11263 contig Csv1_Contig11263:88..725. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: 6DCS_SOYBN (NAD(P)H-dependent 6'-deoxychalcone synthase OS=Glycine max PE=1 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.655e-68
Identity = 130/211 (61.61%), Postives = 169/211 (80.09%), Query Frame = 1
Query:    4 MPVIGLGTAVDKKDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVPLDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGTNQ 636
            MPV+G+G+A D   +   K A++EA+K GYRHFDTA+ YG+E+ALGEA+ EA+ LGL++ RQDLF+T+KLW+ + H  LV+PAL+KSL+TLQ++Y+DLYLIHWP+S++P  K    I  EDL+P D KGVWE+MEECQ+LGLTK IGVSNFS KK++ LL+ +TI P V+QVEMN AWQQ++LREFCK   IIVTAFSPL   G+S G N+
Sbjct:   21 MPVVGMGSAPDFTCKKDTKEAIIEAVKQGYRHFDTAAAYGSEQALGEALKEAIHLGLVS-RQDLFVTSKLWVTENHPHLVLPALRKSLKTLQLEYLDLYLIHWPLSSQPG-KFSFPIEVEDLLPFDVKGVWESMEECQKLGLTKAIGVSNFSVKKLQNLLSVATIRPVVDQVEMNLAWQQKKLREFCKENGIIVTAFSPL-RKGASRGPNE 228          
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: NADO2_ORYSJ (Probable NAD(P)H-dependent oxidoreductase 2 OS=Oryza sativa subsp. japonica GN=Os10g0113100 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.717e-57
Identity = 108/211 (51.18%), Postives = 144/211 (68.25%), Query Frame = 1
Query:    4 MPVIGLGTAVDK-KDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVP-LDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGT 630
            MP IG+GTA            A++ AI+LGYRHFDTA  Y TE  + EA+ EA++ GL+ +R D+F+T+KLW +D H   VVPA +++LR L MDYVDL L+HWP +  P        PKE++ P  D +GVW  MEEC RLGL + IGVSNFS+KK+E LL+F+ + P+ NQVEMNP WQQR LRE C+ + + +  +SPLGA G+ WG+
Sbjct:   18 MPRIGMGTAAFPFTSSEETTAALLRAIELGYRHFDTARLYATEGCVSEAVAEAVRRGLVASRADVFVTSKLWCSDLHAGRVVPAARETLRNLGMDYVDLLLVHWPATVAPG-SYDFPFPKEEMAPAFDMEGVWRGMEECHRLGLARAIGVSNFSAKKLEQLLSFAVVRPAANQVEMNPMWQQRTLREVCRREGVQLCGYSPLGAKGTPWGS 227          
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: NADO1_ORYSJ (Probable NAD(P)H-dependent oxidoreductase 1 OS=Oryza sativa subsp. japonica GN=Os10g0113000 PE=1 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.242e-57
Identity = 107/211 (50.71%), Postives = 146/211 (69.19%), Query Frame = 1
Query:    4 MPVIGLGTAVDK-KDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVP-LDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGT 630
            MP +G+GTA            A++ AI+LGYRHFDTA  Y TE  +GEA+ EA++ GL+ +R D+F+T+K+W +D H   VVPA +++LR L MDYVDL L+HWP+S  P        PKE ++P  D +GVW  MEEC RLGL + IGVSNFS+KK+E LL+ + + P+VNQVE+NP WQQR LRE C+ + + +  +SPLGA G+ WG+
Sbjct:   16 MPRVGMGTAAFPFTSSEDTTAAMLRAIELGYRHFDTARIYATEGCVGEAVAEAVRRGLIASRADVFVTSKIWCSDLHAGRVVPAARETLRNLGMDYVDLLLVHWPVSLTPG-NYDFPFPKEVILPSFDMEGVWRGMEECHRLGLARAIGVSNFSAKKLEQLLSLAAVRPAVNQVEVNPMWQQRTLREVCRREGVQLCGYSPLGAKGTPWGS 225          
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: AK1A1_XENTR (Alcohol dehydrogenase [NADP+] OS=Xenopus tropicalis GN=akr1a1 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.118e-40
Identity = 88/212 (41.51%), Postives = 136/212 (64.15%), Query Frame = 1
Query:    1 EMPVIGLGTAVDKKDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIP----KEDLVPLDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSW 624
            ++P+IGLGT   K     +K AV  A+ +GYRH D A  YG E  +GEAI E++      +R+++F+T+KLW N  H D V  AL+K+L+ LQ+DY+DLYL+HWP + K  +++    P    + DL   DYK  W+AME+  + GLTK IG+SNF+ ++I+ +++ +T+ P+V QVE +P   Q +L  +C +  ++ T +SPLG+   SW
Sbjct:   15 KIPLIGLGTW--KSAPGQVKDAVKYALGVGYRHIDCAFVYGNETEVGEAIKESVGSDKGLSREEVFVTSKLWNNKHHPDDVECALRKTLQDLQLDYLDLYLMHWPYAFKRGDQIFPQNPDGSVQYDLT--DYKDTWKAMEKLVKQGLTKAIGLSNFNKRQIDDIISIATVKPAVLQVECHPYLAQNELIAYCHAHGLVFTGYSPLGSPDRSW 222          
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: AK1A1_RAT (Alcohol dehydrogenase [NADP+] OS=Rattus norvegicus GN=Akr1a1 PE=1 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 2.491e-40
Identity = 87/213 (40.85%), Postives = 137/213 (64.32%), Query Frame = 1
Query:    1 EMPVIGLGTAVDKKDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIPK--EDLVPLD---YKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSW 624
            +MP+IGLGT   K +   +K A+  A+ +GYRH D AS YG E  +GEA+ E++  G    R++LF+T+KLW    H + V PA++K+L  LQ++Y+DLYL+HWP +    E+  +  PK  +  V  D   YK  W+A+E     GL K +G+SNFSS++I+ +L+ +++ P+V QVE +P   Q +L   C+++ + VTA+SPLG++  +W
Sbjct:   13 KMPLIGLGTW--KSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYA---FERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAW 220          
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: AK1A1_XENLA (Alcohol dehydrogenase [NADP+] OS=Xenopus laevis GN=akr1a1 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.248e-40
Identity = 89/212 (41.98%), Postives = 134/212 (63.21%), Query Frame = 1
Query:    1 EMPVIGLGTAVDKKDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIP----KEDLVPLDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSW 624
            +MP+IGLGT   K     +K AV  A+ +GYRH D A  YG E  +GEAI E++       R+++F+T+KLW N  H D V  AL+K+L+ LQ+DY+DLYL+HWP + K  +++    P    + DL   DYK  W+AME+    GL K IG+SNF+ ++++ +L+ +T+ P+V QVE +P   Q +L   C+S  +++T +SPLG+   SW
Sbjct:   15 KMPLIGLGTW--KSAPGQVKDAVKYALGVGYRHIDCAFVYGNETEVGEAIKESVGPDKGLKREEVFVTSKLWNNKHHPDDVECALRKTLQELQLDYLDLYLMHWPYAFKRGDQVFPQNPDGSVQYDLT--DYKDTWKAMEKLVEKGLAKAIGLSNFNKRQMDDILSIATVKPAVLQVECHPYLAQNELIACCRSHGLVLTGYSPLGSPDRSW 222          
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: AK1A1_CHICK (Alcohol dehydrogenase [NADP+] OS=Gallus gallus GN=AKR1A1 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.248e-40
Identity = 87/213 (40.85%), Postives = 132/213 (61.97%), Query Frame = 1
Query:    1 EMPVIGLGTAVDKKDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVPL-----DYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSW 624
            ++P+IGLGT   K +   +K AV  A+ +GYRH D A+ Y  E  +G+A  E +    +  R+DLF+T+KLW    H + V PAL+K+L  L++DY+DLYL+HWP      E+  +L PK     +     DYK  W+AME+    GL K IG+SNF+S++I+ +L+ +T+ P+V QVE +P   Q +L   C+ + ++VTA+SPLG+    W
Sbjct:   15 KIPLIGLGTW--KSEPGQVKEAVKYALSVGYRHVDCAAAYSNEAEIGDAFQECVGPNKVIKREDLFVTSKLWNTKHHPEDVEPALRKTLADLKLDYLDLYLMHWP---HAFERGDNLFPKNPDGTMRYDYTDYKDTWKAMEKLVEKGLAKAIGLSNFNSRQIDDVLSVATVKPAVLQVECHPYLAQNELIAHCQKRGLVVTAYSPLGSPDRMW 222          
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: AK1A1_BOVIN (Alcohol dehydrogenase [NADP+] OS=Bos taurus GN=AKR1A1 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.248e-40
Identity = 87/213 (40.85%), Postives = 137/213 (64.32%), Query Frame = 1
Query:    1 EMPVIGLGTAVDKKDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIPK--EDLVPLD---YKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSW 624
            +MP+IGLGT   K D   +K A+  A+ +GYRH D A+ YG E  +GEA+ E +  G L  R++LF+T+KLW    H + V PAL+K+L  LQ++Y+DLYL+HWP +    E+  S  PK  +  +  D   YK  W A+E     GL + +G+SNF+S++I+ +L+ +++ P+V QVE +P   Q +L   C+++++ VTA+SPLG++  +W
Sbjct:   13 KMPLIGLGTW--KSDPGQVKAAIKYALSVGYRHIDCAAIYGNETEIGEALKENVGPGKLVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYA---FERGDSPFPKNADGTIRYDSTHYKETWRALEALVAKGLVRALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARNLEVTAYSPLGSSDRAW 220          
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: ALDR_PIG (Aldose reductase OS=Sus scrofa GN=AKR1B1 PE=1 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 5.549e-40
Identity = 94/212 (44.34%), Postives = 129/212 (60.85%), Query Frame = 1
Query:    1 EMPVIGLGTAVDKKDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVP--LDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTI--PPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSW 624
            +MP++GLGT   K     +  AV  AI LGYRH D A  Y  E  +G  + E L+ G +  R+DLFI +KLW  D  ++LV  A + +LR L++DY+DLYLIHWP   KP +    L    ++VP   D+   WEAMEE    GL K IGVSNF+  ++E +L    +   P+VNQ+E++P   Q +L E+CKSK I+VTA+SPLG+    W
Sbjct:   12 KMPILGLGTW--KSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQ-GQVVKREDLFIVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPFPLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPW 220          
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Match: AK1A1_MOUSE (Alcohol dehydrogenase [NADP+] OS=Mus musculus GN=Akr1a1 PE=1 SV=3)

HSP 1 Score: 163.31 bits (412), Expect = 9.465e-40
Identity = 87/213 (40.85%), Postives = 135/213 (63.38%), Query Frame = 1
Query:    1 EMPVIGLGTAVDKKDENVMKCAVMEAIKLGYRHFDTASEYGTERALGEAIDEALKLGLLTTRQDLFITTKLWLNDAHRDLVVPALKKSLRTLQMDYVDLYLIHWPISAKPSEKLQSLIPK--EDLVPLD---YKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSW 624
            +MP+IGLGT   K +   +K A+  A+  GYRH D AS YG E  +GEA+ E++  G    R++LF+T+KLW    H + V PAL+K+L  LQ++Y+DLYL+HWP +    E+  +  PK  +  V  D   YK  W+A+E     GL K +G+SNF+S++I+ +L+ +++ P+V QVE +P   Q +L   C ++ + VTA+SPLG++  +W
Sbjct:   13 KMPLIGLGTW--KSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYA---FERGDNPFPKNADGTVRYDSTHYKETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTAYSPLGSSDRAW 220          
The following BLAST results are available for this feature:
BLAST of BQ622993 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 130
Match NameE-valueIdentityDescription
6DCS_SOYBN1.655e-6861.61NAD(P)H-dependent 6'-deoxychalcone synthase OS=Gly... [more]
NADO2_ORYSJ1.717e-5751.18Probable NAD(P)H-dependent oxidoreductase 2 OS=Ory... [more]
NADO1_ORYSJ2.242e-5750.71Probable NAD(P)H-dependent oxidoreductase 1 OS=Ory... [more]
AK1A1_XENTR1.118e-4041.51Alcohol dehydrogenase [NADP+] OS=Xenopus tropicali... [more]
AK1A1_RAT2.491e-4040.85Alcohol dehydrogenase [NADP+] OS=Rattus norvegicus... [more]
AK1A1_XENLA4.248e-4041.98Alcohol dehydrogenase [NADP+] OS=Xenopus laevis GN... [more]
AK1A1_CHICK4.248e-4040.85Alcohol dehydrogenase [NADP+] OS=Gallus gallus GN=... [more]
AK1A1_BOVIN4.248e-4040.85Alcohol dehydrogenase [NADP+] OS=Bos taurus GN=AKR... [more]
ALDR_PIG5.549e-4044.34Aldose reductase OS=Sus scrofa GN=AKR1B1 PE=1 SV=2[more]
AK1A1_MOUSE9.465e-4040.85Alcohol dehydrogenase [NADP+] OS=Mus musculus GN=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00084 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00084 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622993 ID=BQ622993|Name=BQ622993|organism=Citrus sinensis|type=EST|length=638bp
GAGATGCCGGTGATCGGACTGGGCACGGCGGTTGACAAGAAGGATGAAAA
TGTCATGAAGTGTGCAGTAATGGAAGCAATCAAGCTCGGTTACAGACACT
TTGACACAGCTTCAGAGTACGGGACAGAGAGGGCTCTTGGAGAAGCAATC
GATGAAGCACTTAAACTTGGGCTTCTCACTACTCGCCAAGACCTCTTCAT
TACTACTAAGCTCTGGTTGAATGACGCTCATCGTGACCTCGTTGTCCCAG
CTTTGAAGAAGTCTCTTAGGACCCTTCAGATGGACTATGTTGACCTCTAT
CTCATTCACTGGCCCATCAGTGCAAAGCCAAGTGAGAAATTACAAAGCCT
TATACCCAAAGAAGATCTTGTACCATTGGACTACAAGGGTGTGTGGGAAG
CCATGGAAGAGTGCCAGAGGCTTGGCCTCACTAAGTTCATTGGTGTCAGC
AACTTCTCTTCCAAGAAGATTGAGGCTCTACTCGCCTTCTCTACCATCCC
TCCTTCAGTCAATCAAGTGGAGATGAACCCTGCCTGGCAACAGAGACAGC
TCAGAGAATTTTGCAAGTCCAAAAGTATTATTGTAACTGCATTCTCTCCC
TTGGGAGCAGCCGGGTCCAGTTGGGGCACGAATCAAGT
back to top