BQ623022

Overview
NameBQ623022
Unique NameBQ623022
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length673
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3530 contig Csv1_Contig3530:1455..2127. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623022 vs. ExPASy Swiss-Prot
Match: ILV5_ARATH (Ketol-acid reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=At3g58610 PE=2 SV=2)

HSP 1 Score: 271.552 bits (693), Expect = 2.703e-72
Identity = 136/144 (94.44%), Postives = 138/144 (95.83%), Query Frame = 3
Query:    3 AGDLGPLHPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDNDAPINGDLISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQGSN 434
            AGDLGPL+PFTAGVYVALMMAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVD+ A IN DLISNF SDPVHGAIEVCAQLRPTVDISVP DADFVRPELRQ SN
Sbjct:  448 AGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDSGAAINRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN 591          
BLAST of BQ623022 vs. ExPASy Swiss-Prot
Match: ILV5_ORYSJ (Ketol-acid reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0573700 PE=1 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.136e-70
Identity = 130/141 (92.20%), Postives = 135/141 (95.74%), Query Frame = 3
Query:    9 DLGPLHPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDNDAPINGDLISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQGS 431
            DLGPLHPFTAGVYVALMMAQIE+LRKKGHSYSEIINESVIESVDSLNPFMHARGV+FMVDNCSTTARLGSRKWAPRFDYILTQQA V VD DAPIN DLISNF+SDPVHGAIEVCA+LRPTVDISVP +ADFVRPELRQ S
Sbjct:  438 DLGPLHPFTAGVYVALMMAQIEVLRKKGHSYSEIINESVIESVDSLNPFMHARGVAFMVDNCSTTARLGSRKWAPRFDYILTQQAFVTVDKDAPINQDLISNFMSDPVHGAIEVCAELRPTVDISVPANADFVRPELRQSS 578          
BLAST of BQ623022 vs. ExPASy Swiss-Prot
Match: ILV5_PEA (Ketol-acid reductoisomerase, chloroplastic OS=Pisum sativum GN=PGAAIR PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.304e-70
Identity = 130/144 (90.28%), Postives = 139/144 (96.53%), Query Frame = 3
Query:    3 AGDLGPLHPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDNDAPINGDLISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQGSN 434
            AGDLGPL+PFTAGV+VA+MMAQIE+LRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVD+ APIN DLISNF+SDPVHGAI+VCA+LRPT+DISVP  ADFVRPELRQ SN
Sbjct:  438 AGDLGPLYPFTAGVFVAMMMAQIEVLRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDSGAPINQDLISNFVSDPVHGAIQVCAELRPTLDISVPAAADFVRPELRQCSN 581          
BLAST of BQ623022 vs. ExPASy Swiss-Prot
Match: ILV5_SPIOL (Ketol-acid reductoisomerase, chloroplastic OS=Spinacia oleracea GN=AHRI PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.653e-69
Identity = 131/141 (92.91%), Postives = 135/141 (95.74%), Query Frame = 3
Query:    3 AGDLGPLHPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDNDAPINGDLISNFLSDPVHGAIEVCAQLRPTVDISVPPDADFVRPELRQ 425
            AGDLGPL+PFTAGVYVALMMAQIEILRKKGHSYSEIINESVIE+VDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYIL+QQALVAVDN APIN DLISNFLSDPVH AI VCAQLRP+VDISV  DADFVRPELRQ
Sbjct:  454 AGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIEAVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILSQQALVAVDNGAPINQDLISNFLSDPVHEAIGVCAQLRPSVDISVTADADFVRPELRQ 594          
BLAST of BQ623022 vs. ExPASy Swiss-Prot
Match: ILV5_NEUCR (Ketol-acid reductoisomerase, mitochondrial OS=Neurospora crassa GN=ilv-2 PE=3 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 2.038e-11
Identity = 39/86 (45.35%), Postives = 53/86 (61.63%), Query Frame = 3
Query:   54 LMMAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDN---DAPINGD 302
            + +AQ E+LR++GHS SE  NE+V E+  SL P + A G+ +M D CSTTAR G+  W P+F     + AL  V N   D+  NGD
Sbjct:  276 MFLAQYEVLRERGHSPSEAFNETVEEATQSLYPLIGAHGMDWMFDACSTTARRGAIDWTPKF-----KDALKPVFNNLYDSVKNGD 356          
The following BLAST results are available for this feature:
BLAST of BQ623022 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
ILV5_ARATH2.703e-7294.44Ketol-acid reductoisomerase, chloroplastic OS=Arab... [more]
ILV5_ORYSJ1.136e-7092.20Ketol-acid reductoisomerase, chloroplastic OS=Oryz... [more]
ILV5_PEA3.304e-7090.28Ketol-acid reductoisomerase, chloroplastic OS=Pisu... [more]
ILV5_SPIOL3.653e-6992.91Ketol-acid reductoisomerase, chloroplastic OS=Spin... [more]
ILV5_NEUCR2.038e-1145.35Ketol-acid reductoisomerase, mitochondrial OS=Neur... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00113 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00113 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623022 ID=BQ623022|Name=BQ623022|organism=Citrus sinensis|type=EST|length=673bp
CAGCAGGTGACTTAGGCCCATTACACCCATTCACAGCTGGTGTCTATGTG
GCTCTGATGATGGCCCAGATTGAGATCCTGAGGAAGAAAGGGCACTCCTA
TTCTGAGATCATCAATGAAAGTGTGATTGAGTCAGTGGATTCATTGAATC
CATTCATGCATGCTCGTGGAGTTTCATTTATGGTGGACAACTGCTCTACC
ACAGCCCGTTTGGGATCAAGGAAATGGGCCCCTCGTTTTGATTACATCCT
GACACAACAAGCCTTGGTGGCAGTGGACAATGATGCCCCCATCAATGGGG
ATCTCATCAGCAACTTCCTTTCTGATCCAGTCCATGGAGCCATTGAAGTC
TGTGCTCAGTTGAGACCAACTGTTGACATTTCAGTGCCACCAGATGCAGA
TTTTGTGCGCCCAGAGTTGCGTCAGGGTAGCAATTGAGTCCTGGTGAATG
CTTAACTTTTTGTTTCTAGCCCAAAAAATAATTCCCCCTAGGGATATTGT
AGGTAGAGACTTTGCTTAGTCGTGTGAGTTGCTGCTTCTTTATTTAGTTT
TGCTGGGTGAGTGTTGCACTATGTCCGGTTTGGTTGAAGAAGACATGAGA
ATATGCTTTCTGGTTTTTGAATTTGGTGGAATAATAGTATGTTTCCGCGG
AATGTGCTGACAAAAAAAACAAA
back to top