BQ623027

Overview
NameBQ623027
Unique NameBQ623027
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length662
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2414 contig Csv1_Contig2414:102..763. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: GAPN_NICPL (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Nicotiana plumbaginifolia GN=GAPN PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 1.772e-52
Identity = 97/103 (94.17%), Postives = 103/103 (100.00%), Query Frame = 1
Query:    1 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVINLPTPSYTVG 309
            GPVLPVIRINSVEEGIHHCNASNFGLQGCVFT+DINKAILISDAMETGTVQINSAP+RGPDHFPFQG+KDSGIGSQGITNSINMMTK+K+TVINLPTPSYT+G
Sbjct:  394 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSYTMG 496          
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: GAPN_WHEAT (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Triticum aestivum GN=GAPN PE=1 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 3.022e-52
Identity = 97/103 (94.17%), Postives = 103/103 (100.00%), Query Frame = 1
Query:    1 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVINLPTPSYTVG 309
            GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAI+ISDAME+GTVQINSAP+RGPDHFPFQGLKDSGIGSQGITNSINMMTK+KSTVINLP+PSYT+G
Sbjct:  394 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAIMISDAMESGTVQINSAPARGPDHFPFQGLKDSGIGSQGITNSINMMTKVKSTVINLPSPSYTMG 496          
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: GAPN_MAIZE (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Zea mays GN=GPN1 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 6.733e-52
Identity = 97/103 (94.17%), Postives = 102/103 (99.03%), Query Frame = 1
Query:    1 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVINLPTPSYTVG 309
            GPVLPVIRINSVEEGIHHCNASNFGLQGC+FTRDINKAILISDAMETGTVQINSAP+RGPDHF FQGLKDSGIGSQGITNSINMMTK+KSTVINLP+PSYT+G
Sbjct:  396 GPVLPVIRINSVEEGIHHCNASNFGLQGCIFTRDINKAILISDAMETGTVQINSAPARGPDHFSFQGLKDSGIGSQGITNSINMMTKVKSTVINLPSPSYTMG 498          
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: GAPN_PEA (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Pisum sativum GN=GAPN PE=1 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.559e-51
Identity = 94/103 (91.26%), Postives = 103/103 (100.00%), Query Frame = 1
Query:    1 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVINLPTPSYTVG 309
            GPVLPVIRINSVEEGIHHCNASNFGLQGCVFT+DINKAI+ISDAME+GTVQINSAP+RGPDHFPFQG+KDSGIGSQGITNSINMMTK+K+TVINLP+PSYT+G
Sbjct:  394 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIMISDAMESGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPSPSYTMG 496          
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: GAPN_APIGR (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Apium graveolens PE=1 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.342e-51
Identity = 94/103 (91.26%), Postives = 102/103 (99.03%), Query Frame = 1
Query:    1 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVINLPTPSYTVG 309
            GP+LPVIRINS EEGIHHCNASNFGLQGCVFTRDINKA+LISDAME+GT+QINSAP+RGPDHFPFQGLKDSGIGSQGITNSINMMTKIK+TVINLP+PSYT+G
Sbjct:  394 GPILPVIRINSAEEGIHHCNASNFGLQGCVFTRDINKAMLISDAMESGTIQINSAPARGPDHFPFQGLKDSGIGSQGITNSINMMTKIKTTVINLPSPSYTMG 496          
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: GAPN_ARATH (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana GN=ALDH11A3 PE=1 SV=2)

HSP 1 Score: 198.749 bits (504), Expect = 2.166e-50
Identity = 92/103 (89.32%), Postives = 103/103 (100.00%), Query Frame = 1
Query:    1 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVINLPTPSYTVG 309
            GPV+PV+RINSVEEGI+HCNASNFGLQGCVFT+DINKAILISDAMETGTVQINSAP+RGPDHFPFQGLKDSGIGSQG+TNSIN+MTK+K+TVINLPTPSY++G
Sbjct:  394 GPVVPVLRINSVEEGINHCNASNFGLQGCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGLKDSGIGSQGVTNSINLMTKVKTTVINLPTPSYSMG 496          
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: GAPN_STREI (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus equinus GN=gapN PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.369e-20
Identity = 50/95 (52.63%), Postives = 62/95 (65.26%), Query Frame = 1
Query:    1 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVINL 285
            GPVLP IR+NSVEE I   N S +GLQ  VFT +   A  I++ +E GTV IN+   RG D+FPF G K SG G QG+  SI  MT +KSTV ++
Sbjct:  380 GPVLPFIRVNSVEEAIEISNKSEYGLQASVFTNNFPLAFKIAEQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGVQGVKYSIEAMTTVKSTVFDI 474          
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: GAPN_STRMU (NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus mutans GN=gapN PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.788e-20
Identity = 48/95 (50.53%), Postives = 62/95 (65.26%), Query Frame = 1
Query:    1 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVINL 285
            GPVLP+IR+ SVEE I   N S +GLQ  +FT D  +A  I++ +E GTV IN+   RG D+FPF G K SG G QG+  SI  MT +KS V ++
Sbjct:  380 GPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIAEQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDI 474          
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: LADH_META3 (Lactaldehyde dehydrogenase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_1030 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.405e-19
Identity = 43/93 (46.24%), Postives = 67/93 (72.04%), Query Frame = 1
Query:    4 PVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVIN 282
            PVLP+IR+N + E ++  N SN+GL   VFT+DINKA+  +D +E G V IN++P+   D+ PF G+K SG+G +GI  +I+ M++IK+ ++N
Sbjct:  371 PVLPIIRVNDMNEALNQANNSNYGLHSGVFTQDINKALYFADNLEYGGVLINNSPTFRIDNMPFGGIKHSGLGREGIKYAIDEMSEIKTIIVN 463          
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Match: LADH_METM7 (Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0731 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.870e-18
Identity = 42/94 (44.68%), Postives = 65/94 (69.15%), Query Frame = 1
Query:    1 GPVLPVIRINSVEEGIHHCNASNFGLQGCVFTRDINKAILISDAMETGTVQINSAPSRGPDHFPFQGLKDSGIGSQGITNSINMMTKIKSTVIN 282
            GPVLP++++ + EE +   N S +GLQ  VFT DINKA+ I+D++E G + INS+P+   D+ PF G+K SG+G +GI  ++  M + K+ VI+
Sbjct:  370 GPVLPILKVKNSEEAVSIANNSKYGLQAGVFTNDINKAMKIADSLEYGGIMINSSPTFRKDNMPFGGVKKSGLGREGIKYTVEEMCETKTVVIH 463          
The following BLAST results are available for this feature:
BLAST of BQ623027 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
GAPN_NICPL1.772e-5294.17NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_WHEAT3.022e-5294.17NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_MAIZE6.733e-5294.17NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_PEA2.559e-5191.26NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_APIGR3.342e-5191.26NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_ARATH2.166e-5089.32NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_STREI1.369e-2052.63NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
GAPN_STRMU1.788e-2050.53NADP-dependent glyceraldehyde-3-phosphate dehydrog... [more]
LADH_META34.405e-1946.24Lactaldehyde dehydrogenase OS=Methanococcus aeolic... [more]
LADH_METM74.870e-1844.68Lactaldehyde dehydrogenase OS=Methanococcus maripa... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00118 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00118 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623027 ID=BQ623027|Name=BQ623027|organism=Citrus sinensis|type=EST|length=662bp
GGTCCTGTTCTGCCAGTTATTAGGATAAACTCGGTCGAAGAAGGAATCCA
CCATTGTAATGCTAGCAACTTTGGTCTTCAGGGATGTGTATTTACTAGGG
ATATAAACAAAGCAATTTTAATCAGTGACGCGATGGAAACAGGAACGGTT
CAGATTAATTCAGCTCCGTCTCGTGGACCTGATCATTTTCCTTTCCAGGG
CTTAAAGGACAGCGGAATTGGTTCACAGGGAATCACCAATAGCATCAATA
TGATGACGAAAATCAAGAGCACTGTAATCAATTTACCAACCCCGTCTTAC
ACCGTAGGTTGATGATAATTAATAGGAGCATCGAGCTACACTCACCTTAT
AGAGTACATGTTATCTATCTACCTAGAGTATATAACTGGCAAAATAAAAT
CACTGTATGTTATCTTCCTTGCCTTCACGGGCAAGTAATCGGCACTTGCA
TGTACCCACAAGTTTCTTGTGGTTATCTTATTGTTTAAATTGGCTCTGGT
TATATAAGTAAAGATGATGGAGTGTTATTTGATTTTTTTTTTTTTTCAAA
TTGAATTTATGGTAAGGTATTTGTAATTATAGCTGCCCCTACTTTATTGG
GATTCTTTCCATATGTAACAACACCATGCAGGGATAAGATCATTGAGGAA
ACAAAGGTTATG
back to top