BQ623034

Overview
NameBQ623034
Unique NameBQ623034
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length714
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6 contig Csv1_Contig6:1..714. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: HYES_PIG (Epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.773e-39
Identity = 87/230 (37.83%), Postives = 123/230 (53.48%), Query Frame = 3
Query:   12 GIWMHIAEKGQGPLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALVNLGVAYMPRSPELKPTEIFSKLYGEGFYISQFQEPGVAEKSFSKYDSLTVLKKLLLVNAPDIIAAPAGVEIID-FLHTPS--SLPEWVNLEDLQSWAEKFNATGFTGALNYYRAMDKNWE 692
            G+ +H  E G GP V L HGFPE W  W+YQI  LA+ G+ V+A DM+GYG+S +P + E Y++                 QA  +GHDWG  + WN+ LF P+RV+A+ +L   +MP +P + P EI  K      Y   FQEPGVAE    +    T  K     +    +      E+   F+ TP   SL   V  ED+Q + ++F  +GF G LN+YR M++NW+
Sbjct:  247 GVRLHFVEMGSGPAVCLCHGFPESWFSWRYQIPALAQAGFRVLAVDMKGYGESSAPPEIEEYSLEVLCKDMVTFLNKLGLSQAVFIGHDWGGVLVWNMALFYPERVRAVASLNTPFMPSNPNVSPMEII-KANPVFDYQLYFQEPGVAEAELEQNLDRT-FKNFFRAHDETFLTTNRVRELGGLFVGTPEEPSLSRLVTEEDIQFYVQQFKKSGFRGPLNWYRNMERNWQ 474          
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: HYES_MOUSE (Epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2)

HSP 1 Score: 158.688 bits (400), Expect = 2.844e-38
Identity = 84/230 (36.52%), Postives = 122/230 (53.04%), Query Frame = 3
Query:   12 GIWMHIAEKGQGPLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALVNLGVAYMPRSPELKPTEIFSKLYGEGFYISQFQEPGVAEKSFSKYDSLTVLKKLLLVNAPDIIAAPAGVEIIDFL-HTPS--SLPEWVNLEDLQSWAEKFNATGFTGALNYYRAMDKNWE 692
            GI +H  E G GP + L HGFPE W  W+YQI  LA+ G+ V+A DM+GYGDS SP + E Y +                 QA  +GHDW   + WN+ LF P+RV+A+ +L   +MP  P++ P ++   +    + +  FQEPGVAE    K  S T        +    IA     EI   L +TP   +L +    E+++ + ++F  TGF G LN+YR  ++NW+
Sbjct:  245 GIRLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAQAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCKEMVTFLDKLGIPQAVFIGHDWAGVMVWNMALFYPERVRAVASLNTPFMPPDPDVSPMKVIRSIPVFNYQL-YFQEPGVAEAELEKNMSRTFKSFFRASDETGFIAVHKATEIGGILVNTPEDPNLSKITTEEEIEFYIQQFKKTGFRGPLNWYRNTERNWK 473          
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: HYES_RAT (Epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.363e-37
Identity = 81/230 (35.22%), Postives = 120/230 (52.17%), Query Frame = 3
Query:   12 GIWMHIAEKGQGPLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALVNLGVAYMPRSPELKPTEIFSKLYGEGFYISQFQEPGVAEKSFSKYDSLTVLKKLLLVNAPDIIAAPAGVEIIDFL-HTPS--SLPEWVNLEDLQSWAEKFNATGFTGALNYYRAMDKNWE 692
            GI +H  E G GP + L HGFPE W  W+YQI  LA+ G+ V+A DM+GYGDS SP + E Y +                 QA  +GHDW   + WN+ LF P+RV+A+ +L    MP +PE+ P E+   +    + +  FQEPGVAE    K  S T        +   ++      E+   L  TP    + +    E+++ + ++F  +GF G LN+YR  ++NW+
Sbjct:  245 GIRLHFVEMGSGPAICLCHGFPESWFSWRYQIPALAQAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCEEMVTFLNKLGIPQAVFIGHDWAGVLVWNMALFHPERVRAVASLNTPLMPPNPEVSPMEVIRSIPVFNYQL-YFQEPGVAEAELEKNMSRTFKSFFRTSDDMGLLTVNKATEMGGILVGTPEDPKVSKITTEEEIEYYIQQFKKSGFRGPLNWYRNTERNWK 473          
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: HYES_HUMAN (Epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2)

HSP 1 Score: 154.451 bits (389), Expect = 5.363e-37
Identity = 84/227 (37.00%), Postives = 122/227 (53.74%), Query Frame = 3
Query:   21 MHIAEKGQGPLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALVNLGVAYMPRSPELKPTEIFSKLYGEGFYISQFQEPGVAEKSFSKYDSLTVLKKLLLVNAPDIIAAPAGVEIID-FLHTPS--SLPEWVNLEDLQSWAEKFNATGFTGALNYYRAMDKNWE 692
            +H  E G GP V L HGFPE W  W+YQI  LA+ GY V+A DM+GYG+S +P + E Y +                 QA  +GHDWG  + W + LF P+RV+A+ +L   ++P +P + P E   K      Y   FQEPGVAE    +  S T  K L   +   +++     E    F+++P   SL   V  E++Q + ++F  +GF G LN+YR M++NW+
Sbjct:  250 LHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESI-KANPVFDYQLYFQEPGVAEAELEQNLSRT-FKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWK 474          
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: YFHM_BACSU (AB hydrolase superfamily protein yfhM OS=Bacillus subtilis GN=yfhM PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.043e-28
Identity = 76/231 (32.90%), Postives = 115/231 (49.78%), Query Frame = 3
Query:    3 HTNGIWMHIAEKGQ--GPLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALVNLGVAYMPRSPELKP-TEIFSKLYGEGFYISQFQEPGVAEKSFSKYDSLTVLKKLLLVNAPDIIAAPAGVEIIDFLHTPSSLPEWVNLEDLQSWAEKFNATG-FTGALNYYRAMDK 683
            +TNGI +H+A  G+  GPL++L+HGFPE W  WK QI  L + GY V+APD RGY  SD P+  +SY I                 +A V+GHDWG  +AW+L   RP+ ++ L+ + +   P    +K  T ++   + +  YI+ FQ P + E S  + D  T+ K + L + P +  +                      ED+  + E +   G  T  LN+YRA+ K
Sbjct:   10 NTNGITLHVAAAGREDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINI---PHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYDTLDKAIGLSDRPALFTS----------------------EDVSRYKEAWKQPGALTAMLNWYRALRK 215          
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: EPHX3_HUMAN (Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.407e-23
Identity = 75/241 (31.12%), Postives = 115/241 (47.72%), Query Frame = 3
Query:    6 TNGIWMHI--AEKGQGPLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALVNLGVAYMPRSPELKPTEIFSKLYGEGFYISQFQEPGVAEKSFSKYDSLTVLKKLLLVNAPDIIAAPAGVEIIDFLHTPSSLPEWVNLEDLQSWAEKFNAT-GFTGALNYYRAMDKNW-----ELTAP 704
            ++G+ +H   A +G GPL+L +HGFPE W  W+YQ+    +  +HVVA D+RGYG SD+P+D + YTI                 +  +V HDWGA +AW+  ++ P  V+ +V +  A M    +     I    +    Y+  FQ P + EK  S  D   +LK  L                    H  + +P  +   +L+++   F+   G TG LNYYR + +N+     ELT P
Sbjct:   82 SSGLRLHYVSAGRGNGPLMLFLHGFPENWFSWRYQLREF-QSRFHVVAVDLRGYGPSDAPRDVDCYTIDLLLVDIKDVILGLGYSKCILVAHDWGALLAWHFSIYYPSLVERMVVVSGAPMSVYQDYSLHHI--SQFFRSHYMFLFQLPWLPEKLLSMSD-FQILKTTL-------------------THRKTGIP-CLTPSELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTP 298          
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: EPHX3_MOUSE (Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 4.873e-22
Identity = 74/236 (31.36%), Postives = 112/236 (47.46%), Query Frame = 3
Query:    6 TNGIWMHI--AEKGQGPLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALVNLGVAYMPRSPELKPTEIFSKLYGEGF---YISQFQEPGVAEKSFSKYDSLTVLKKLLLVNAPDIIAAPAGVEIIDFLHTPSSLPEWVNLEDLQSWAEKFNATG-FTGALNYYRAMDKNWEL 695
            ++G+ +H   A  G GPL+L +HGFPE W  W+YQ+     H +HVVA DMRGY  SD+P++ + YTI                 +  +V HDWGA +AW   ++ P  V+ +V   VA  P    ++   I     G+ F   Y+  FQ P + EK  S  D   +LK                     F H  + +P  +   +L+++   F+  G  TG +NYYR + +N+ L
Sbjct:   89 SSGLRLHYVSAGHGNGPLMLFLHGFPENWFSWRYQLREFQSH-FHVVAVDMRGYSPSDAPKEVDCYTIDLLLDDIKDTILGLGYSKCILVSHDWGASLAWEFSIYYPSLVERMV---VANGPPMSVIQEYSIHH--IGQIFRSNYMFLFQLPWLPEKLLSMSD-FQILKD-------------------TFTHRKNGIP-GLTPSELEAFLYHFSQPGCLTGPINYYRNVFRNFPL 297          
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: EPHX4_MOUSE (Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.575e-18
Identity = 67/231 (29.00%), Postives = 102/231 (44.16%), Query Frame = 3
Query:    9 NGIWMHIAEKGQG--PLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALV-------NLGVAYMPRSPELKPTEIFSKLYGEGFYISQFQEPGVAEKSFSKYDSLTVLKKLLLVNAPDIIAAPAGVEIIDFLHTPSSLPEWVNLEDLQSWAEKFNATG-FTGALNYYR 671
            +G+  H    G+   PL+LL+HGFPE W  W++Q+       Y VVA D+RGYG+SD+P   ESY +                 +  ++GHDWG  IAW + +  P+ +  L+       ++   Y+ R P        ++L+   FY   FQ P   E  FS  D   VLK L    +  I                      +  EDL+++   F+  G  +G +N+YR
Sbjct:   77 SGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRHQLREFKSE-YRVVALDLRGYGESDAPAHQESYKLDCLIADIKDILDSLGYSKCVLIGHDWGGMIAWLIAVCYPEMIMKLIVINFPHPSVFTEYILRHP--------AQLFRSSFYYF-FQIPRFPEFMFSIND-FKVLKHLFTSQSTGI----------------GRKGRQLTTEDLEAYVYVFSQPGALSGPINHYR 280          
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: EPHX4_HUMAN (Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 2.767e-17
Identity = 67/231 (29.00%), Postives = 104/231 (45.02%), Query Frame = 3
Query:    9 NGIWMHIAEKGQG--PLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALV-------NLGVAYMPRSPELKPTEIFSKLYGEGFYISQFQEPGVAEKSFSKYDSLTVLKKLLLVNAPDIIAAPAGVEIIDFLHTPSSLPEWVNLEDLQSWAEKFNATG-FTGALNYYR 671
            +G+  H    G+   PL+LL+HGFPE W  W+YQ+       Y VVA D+RGYG++D+P   ++Y +                 +  ++GHDWG  IAW + +  P+ V  L+       N+   Y+ R P        ++L    +Y   FQ P   E  FS  D   VLK L   ++  I     G ++                EDL+++   F+  G  +G +N+YR
Sbjct:   79 SGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSE-YRVVALDLRGYGETDAPIHRQNYKLDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVMKLIVINFPHPNVFTEYILRHP--------AQLLKSSYYYF-FQIPWFPEFMFSIND-FKVLKHLFTSHSTGI--GRKGCQL--------------TTEDLEAYIYVFSQPGALSGPINHYR 282          
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Match: EPHX3_XENTR (Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.059e-16
Identity = 53/170 (31.18%), Postives = 80/170 (47.06%), Query Frame = 3
Query:    9 NGIWMHIAEKG--QGPLVLLIHGFPELWSCWKYQINHLAEHGYHVVAPDMRGYGDSDSPQDPESYTIFHXXXXXXXXXXXXXXXQAFVVGHDWGAQIAWNLCLFRPDRVKALVNLGVAYMPRSPEL---KPTEIFSKLYGEGFYISQFQEPGVAEKSFSKYDSLTVLKKL 503
            +GI  H    G  + PL+LL+HGFPE W  W+YQ++  + +GY  VA D+RG+G SD+P   E Y +                 +  +VGHDWG  +AW   +   D V  L+ +   +     +     P+++FS       Y+  FQ P + E   S  D   + K L
Sbjct:   83 SGIRFHYVASGDKRNPLMLLLHGFPENWYSWRYQLDEFS-NGYRTVAIDLRGFGGSDAPSRLEDYKMEILLQDLQDLIRGLGYSRCVLVGHDWGGTLAWTFAVRHRDMVTHLIVMNAPHPSAFHDYVLSHPSQLFSSR-----YVFLFQLPLIPEILLSLRDFEHIKKPL 246          
The following BLAST results are available for this feature:
BLAST of BQ623034 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
HYES_PIG9.773e-3937.83Epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV... [more]
HYES_MOUSE2.844e-3836.52Epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 ... [more]
HYES_RAT5.363e-3735.22Epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 ... [more]
HYES_HUMAN5.363e-3737.00Epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 ... [more]
YFHM_BACSU2.043e-2832.90AB hydrolase superfamily protein yfhM OS=Bacillus ... [more]
EPHX3_HUMAN4.407e-2331.12Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 ... [more]
EPHX3_MOUSE4.873e-2231.36Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 ... [more]
EPHX4_MOUSE5.575e-1829.00Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 ... [more]
EPHX4_HUMAN2.767e-1729.00Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 ... [more]
EPHX3_XENTR3.059e-1631.18Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00125 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00125 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623034 ID=BQ623034|Name=BQ623034|organism=Citrus sinensis|type=EST|length=714bp
TTCACACTAATGGAATATGGATGCACATAGCAGAAAAAGGGCAAGGACCC
CTTGTTCTGCTCATTCATGGCTTCCCTGAACTTTGGTCTTGCTGGAAGTA
CCAGATAAATCATTTGGCTGAGCATGGTTACCATGTTGTTGCGCCCGATA
TGCGAGGCTACGGGGACTCAGATTCTCCTCAGGATCCTGAATCATATACA
ATTTTTCATCTCGTTGGCGATTTGATTGGCCTTCTGGATGAGCTTGGAGA
AGAACAGGCATTTGTAGTGGGACACGACTGGGGTGCACAAATTGCTTGGA
ACCTCTGCCTCTTTAGGCCAGATAGGGTAAAAGCTCTTGTTAACTTAGGT
GTTGCTTACATGCCACGCTCCCCGGAACTCAAACCAACTGAAATATTTTC
CAAATTATATGGAGAAGGATTCTACATTTCTCAATTTCAGGAGCCTGGAG
TTGCTGAAAAATCGTTCTCCAAGTATGACTCTTTGACAGTTTTGAAGAAG
CTTTTGCTCGTAAATGCTCCTGATATTATTGCCGCTCCCGCTGGAGTTGA
AATCATCGACTTTCTTCACACCCCATCTTCATTACCTGAGTGGGTGAACT
TGGAAGATCTGCAATCCTGGGCAGAAAAATTCAATGCAACAGGTTTCACC
GGGGCACTGAACTACTACCGTGCCATGGACAAGAACTGGGAGCTAACAGC
ACCATGGCAGGGTG
back to top