BQ623044

Overview
NameBQ623044
Unique NameBQ623044
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length372
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623044_ssr1 microsatellite BQ623044_ssr1:1..12. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig12813 contig Csv1_Contig12813:131..502. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMP1B_ARATH (Methionine aminopeptidase 1B, chloroplastic OS=Arabidopsis thaliana GN=MAP1B PE=2 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 1.188e-39
Identity = 69/84 (82.14%), Postives = 76/84 (90.48%), Query Frame = 2
Query:   56 RFVGHGVGKVFHSEPIIYHNRNENPGCMVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILTIC 307
            RFVGHGVG VFHSEP+IYH RN+ PG MVEGQTFTIEPILT+G+ EC+TWPDNWTTLTADG  AAQFEH+ILITRTG+EILT C
Sbjct:  286 RFVGHGVGPVFHSEPLIYHYRNDEPGLMVEGQTFTIEPILTIGTTECVTWPDNWTTLTADGGVAAQFEHTILITRTGSEILTKC 369          

HSP 2 Score: 29.6462 bits (65), Expect = 1.188e-39
Identity = 12/18 (66.67%), Postives = 15/18 (83.33%), Query Frame = 1
Query:    7 ERTSEHAEKYGFGVVEPF 60
            +R SEHAEK+G+ VVE F
Sbjct:  270 KRISEHAEKFGYNVVERF 287          
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMP1C_ARATH (Methionine aminopeptidase 1C, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=MAP1C PE=2 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 6.670e-28
Identity = 58/85 (68.24%), Postives = 69/85 (81.18%), Query Frame = 2
Query:   56 RFVGHGVGKVFHSEPIIYHNRNENPGC--MVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILTI 304
            RF+GHGVG V HSEP+IY + N +     M+EGQTFT+EPILT+G+ E +TWPD WT +TADG PAAQFEH+ILIT TGAEILTI
Sbjct:  258 RFIGHGVGTVLHSEPLIYLHSNYDYELEYMIEGQTFTLEPILTIGTTEFVTWPDKWTIVTADGGPAAQFEHTILITTTGAEILTI 342          
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMP1D_ARATH (Methionine aminopeptidase 1D, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=MAP1D PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.816e-25
Identity = 53/84 (63.10%), Postives = 64/84 (76.19%), Query Frame = 2
Query:   56 RFVGHGVGKVFHSEPIIYHNRNENPGCMVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILTIC 307
            +FVGHGVG VFH++P++ H RN   G MV  QTFTIEP+LT+GS   I W DNWT +T D S +AQFEH+ILIT+ GAEILT C
Sbjct:  267 QFVGHGVGSVFHADPVVLHFRNNEAGRMVLNQTFTIEPMLTIGSRNPIMWDDNWTVVTEDASLSAQFEHTILITKDGAEILTKC 350          
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMPM1_DICDI (Methionine aminopeptidase 1 OS=Dictyostelium discoideum GN=metap1 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.639e-20
Identity = 43/94 (45.74%), Postives = 62/94 (65.96%), Query Frame = 2
Query:   59 FVGHGVGKVFHSEPIIYH-NRNENPGCMVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILTIC*NNHLITNNF 337
            F GHG+G++FH  P + H ++N+  G M  G  FTIEP++  G+ +   WPD+WT +TADG  +AQFEH+++IT TG E+LT   N   I  +F
Sbjct:  273 FCGHGIGRLFHCNPTVPHYSKNKAVGAMKVGHVFTIEPMINEGTWQDEIWPDSWTAVTADGKRSAQFEHTLVITETGCEVLTKRTNGSYIDRHF 366          

HSP 2 Score: 24.2534 bits (51), Expect = 1.639e-20
Identity = 9/15 (60.00%), Postives = 11/15 (73.33%), Query Frame = 1
Query:   19 EHAEKYGFGVVEPFC 63
            +HA K GF VV+ FC
Sbjct:  260 KHANKQGFSVVKNFC 274          
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMPM1_SCHPO (Probable methionine aminopeptidase 1 OS=Schizosaccharomyces pombe GN=SPBC3E7.10 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.119e-20
Identity = 43/82 (52.44%), Postives = 58/82 (70.73%), Query Frame = 2
Query:   59 FVGHGVGKVFHSEPIIYH-NRNENPGCMVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILT 301
            + GHG+ ++FH  P I H + N+ PG    G TFTIEP+LT+G    ITWPD+WT+ TA G  +AQFEH++L+T TG E+LT
Sbjct:  286 YCGHGINQLFHCSPSIPHYSHNKAPGIARPGMTFTIEPMLTLGPARDITWPDDWTSSTASGRCSAQFEHTLLVTETGCEVLT 367          
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMP1A_ARATH (Methionine aminopeptidase 1A OS=Arabidopsis thaliana GN=MAP1A PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.731e-20
Identity = 44/82 (53.66%), Postives = 56/82 (68.29%), Query Frame = 2
Query:   59 FVGHGVGKVFHSEPIIYHN-RNENPGCMVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILT 301
            + GHG+G +FH  P I H  RN+  G M  GQTFTIEP++  G     TWPD WT +TADG  +AQFEH++L+T TG E+LT
Sbjct:  302 YCGHGIGDLFHCAPNIPHYARNKAVGVMKAGQTFTIEPMINAGGWRDRTWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLT 383          
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMPM1_YEAST (Methionine aminopeptidase 1 OS=Saccharomyces cerevisiae GN=MAP1 PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 7.392e-19
Identity = 42/82 (51.22%), Postives = 56/82 (68.29%), Query Frame = 2
Query:   59 FVGHGVGKVFHSEPIIYHN-RNENPGCMVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILT 301
            + GHGVG+ FH  P I H  +N  PG M  G  FTIEP++  G+ + +TWPD+WT+ T DG  +AQFEH++L+T  G EILT
Sbjct:  291 YCGHGVGEFFHCSPNIPHYAKNRTPGVMKPGMVFTIEPMINEGTWKDMTWPDDWTSTTQDGKLSAQFEHTLLVTEHGVEILT 372          
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMP1D_MOUSE (Methionine aminopeptidase 1D, mitochondrial OS=Mus musculus GN=Map1d PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.668e-18
Identity = 43/81 (53.09%), Postives = 53/81 (65.43%), Query Frame = 2
Query:   59 FVGHGVGKVFHSEPIIYHNRNENPGCMVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILT 301
            FVGHG+G  FH  P I+H+ N+N   M EG  FTIEPI+T GS E     D WT ++ D   +AQFEH++LIT  G EILT
Sbjct:  249 FVGHGIGSYFHGHPEIWHHANDNDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITPRGVEILT 329          
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMPM1_XENLA (Methionine aminopeptidase 1 OS=Xenopus laevis GN=metap1 PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 4.079e-18
Identity = 40/82 (48.78%), Postives = 55/82 (67.07%), Query Frame = 2
Query:   59 FVGHGVGKVFHSEPIIYH-NRNENPGCMVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILT 301
            + GHG+ K+FH+ P + H  +N+  G M  G  FTIEP++  G  +  TWPD WT +T DG  +AQFEH++L+T TG EILT
Sbjct:  291 YCGHGIHKLFHTAPNVPHYGKNKAVGVMKPGHVFTIEPMICEGGWQDETWPDGWTAITRDGKRSAQFEHTLLVTETGCEILT 372          

HSP 2 Score: 20.7866 bits (42), Expect = 4.079e-18
Identity = 6/15 (40.00%), Postives = 10/15 (66.67%), Query Frame = 1
Query:   19 EHAEKYGFGVVEPFC 63
            +HA+  GF +V  +C
Sbjct:  278 KHAQANGFSIVRSYC 292          
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Match: AMPM1_BOVIN (Methionine aminopeptidase 1 OS=Bos taurus GN=METAP1 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 5.302e-18
Identity = 40/82 (48.78%), Postives = 56/82 (68.29%), Query Frame = 2
Query:   59 FVGHGVGKVFHSEPIIYH-NRNENPGCMVEGQTFTIEPILTMGSIECITWPDNWTTLTADGSPAAQFEHSILITRTGAEILT 301
            + GHG+ K+FH+ P + H ++N+  G M  G  FTIEP++  G  +  TWPD WT +T DG  +AQFEH++L+T TG EILT
Sbjct:  291 YCGHGIHKLFHTAPNVPHYSKNKAVGVMKAGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILT 372          

HSP 2 Score: 21.1718 bits (43), Expect = 5.302e-18
Identity = 7/15 (46.67%), Postives = 10/15 (66.67%), Query Frame = 1
Query:   19 EHAEKYGFGVVEPFC 63
            +HA+  GF VV  +C
Sbjct:  278 KHAQANGFSVVRSYC 292          
The following BLAST results are available for this feature:
BLAST of BQ623044 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
AMP1B_ARATH1.188e-3982.14Methionine aminopeptidase 1B, chloroplastic OS=Ara... [more]
AMP1C_ARATH6.670e-2868.24Methionine aminopeptidase 1C, chloroplastic/mitoch... [more]
AMP1D_ARATH1.816e-2563.10Methionine aminopeptidase 1D, chloroplastic/mitoch... [more]
AMPM1_DICDI1.639e-2045.74Methionine aminopeptidase 1 OS=Dictyostelium disco... [more]
AMPM1_SCHPO5.119e-2052.44Probable methionine aminopeptidase 1 OS=Schizosacc... [more]
AMP1A_ARATH8.731e-2053.66Methionine aminopeptidase 1A OS=Arabidopsis thalia... [more]
AMPM1_YEAST7.392e-1951.22Methionine aminopeptidase 1 OS=Saccharomyces cerev... [more]
AMP1D_MOUSE3.668e-1853.09Methionine aminopeptidase 1D, mitochondrial OS=Mus... [more]
AMPM1_XENLA4.079e-1848.78Methionine aminopeptidase 1 OS=Xenopus laevis GN=m... [more]
AMPM1_BOVIN5.302e-1848.78Methionine aminopeptidase 1 OS=Bos taurus GN=METAP... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00135 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00135 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623044 ID=BQ623044|Name=BQ623044|organism=Citrus sinensis|type=EST|length=372bp
GAGAGAGAGAGAACTAGTGAGCACGCTGAGAAATATGGTTTCGGTGTAGT
GGAACCGTTTTGTTGGGCATGGCGTAGGGAAAGTCTTTCATTCCGAGCCA
ATCATATATCATAACCGTAATGAAAATCCTGGCTGTATGGTTGAAGGTCA
AACATTTACAATTGAACCAATTCTTACAATGGGAAGCATTGAGTGTATAA
CTTGGCCTGACAACTGGACGACTTTGACTGCTGATGGCAGCCCTGCTGCA
CAGTTTGAGCATTCTATTTTAATTACTAGAACTGGCGCAGAAATTTTAAC
AATATGTTGAAACAATCATTTGATTACTAATAATTTTTGGCCACATTGTA
CAATAATATAAGTACATGGTGA
back to top