BQ623046

Overview
NameBQ623046
Unique NameBQ623046
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length661
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3580 contig Csv1_Contig3580:34..693. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623046 vs. ExPASy Swiss-Prot
Match: PP399_ARATH (Pentatricopeptide repeat-containing protein At5g27270 OS=Arabidopsis thaliana GN=EMB976 PE=2 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 4.449e-13
Identity = 30/62 (48.39%), Postives = 40/62 (64.52%), Query Frame = 1
Query:  103 SQPGIIPDLACYRTMLKGYMDHGYIEEGINLFEE-VRESSESDKFIMSAAVHLYRYAGKEHE 285
            S+ GI PD AC RT+LKGYM  G  E+GI  +E+ +R S E D+F+ S    LY+  GKE +
Sbjct:  976 SEAGISPDSACKRTILKGYMTCGDAEKGILFYEKMIRSSVEDDRFVSSVVEDLYKAVGKEQD 1037          

HSP 2 Score: 35.039 bits (79), Expect = 4.449e-13
Identity = 17/30 (56.67%), Postives = 21/30 (70.00%), Query Frame = 2
Query:    2 QGIPPSCTHVNHLLSAFSKAGLMAEATRVY 91
            +GIP S +H + LLSA  KAG+M EA R Y
Sbjct:  943 KGIPLSHSHFSSLLSALVKAGMMEEAERTY 972          
The following BLAST results are available for this feature:
BLAST of BQ623046 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PP399_ARATH4.449e-1348.39Pentatricopeptide repeat-containing protein At5g27... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00137 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00137 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623046 ID=BQ623046|Name=BQ623046|organism=Citrus sinensis|type=EST|length=661bp
GCAAGGGATTCCCCCTTCGTGCACACATGTCAACCACTTGCTATCTGCTT
TTTCTAAGGCGGGTCTGATGGCAGAGGCTACAAGGGTTTACAATGAATCA
CCTCGCAGCCTGGTATAATTCCTGACCTTGCTTGTTATCGGACAATGCTG
AAAGGTTACATGGACCATGGATACATTGAGGAAGGAATAAACCTTTTTGA
AGAGGTCAGAGAGTCCTCAGAATCAGACAAGTTTATCATGAGTGCGGCTG
TGCATTTATACCGGTATGCAGGGAAGGAACATGAAGCGAATGATATTTTG
GATTCAATGAATTCTGTGAGAATACCATTCCTGAAGAACCCTGGAAGTTG
GATCAAAGATAAAACCCTCATAGATCCTATTGTATCTAACACTTAATACA
ACTGAATTCTGGATATTCTGATTTGAGGCAAAGGACTTATGATGAAGAAA
GGCCAGGTAATAGTTTACTGGTCGGGGAAATGGTCATTGGATTGTACCTC
TGGTGGTATATGAGGTCTGAAAGTACAGAGATACTGGTGATAGCTTCTTG
CAAACGGCGCTGATATTTGCCTCCAGACGTTGGATATGCAGTGCATGGGA
ATCAATAGCTGCAGCCTGATACAGCTGCTGATCACGAGCCTGCATATTAA
GATATGGGGAT
back to top