BQ623054

Overview
NameBQ623054
Unique NameBQ623054
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10290 contig Csv1_Contig10290:304..940. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623054 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 80.1073 bits (196), Expect = 1.054e-14
Identity = 69/222 (31.08%), Postives = 108/222 (48.65%), Query Frame = 2
Query:   11 MKTSLVTTLSFL----ILALATKPQLGASES--EPILDVYGNQVDSSHRYYLVSALWGVKTGGGISADKGK-NGQ--CPTDVIQLSPKDKRGKNLGLLPYD-NSTIVRESTNIKLKFSRVSSLQQCNKDSLWKVDNDNASLGKQFITIGEGK------TCQNFFKLEKVSASIFDMKIALDIPCLYKIVHCSTLVNGSCDTLCKDVGV-SNVDGVQRLVVGD 625
            MK   + +LSF     +LA A  P L A++S   P+LD+ G ++ +   YY+V  L     GGG++      NG   CP  V+Q   +    + L   P +    +VR ST++ + FS     +  +  ++W++D  + S G+ F+TIG  K      T  ++FK+E+   S F           YK+V C T V GSC   C DVG+  +  G +RL + D
Sbjct:    1 MKELTMLSLSFFFVSALLAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRD--HGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSS-TVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGF-----------YKLVFCPT-VCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
BLAST of BQ623054 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.682e-12
Identity = 59/217 (27.19%), Postives = 107/217 (49.31%), Query Frame = 2
Query:   11 MKTSLVTTLSFLILALATKPQ---LGASESEPILDVYGNQVDSSHRYYLVSALWGVKTGGGISADKGKNGQCPTDVIQLSPKDKRGKNLGLLPYDN-STIVRESTNIKLKFSRVSSLQQCNKDSLWKVDNDNASLGKQFITIGEGK------TCQNFFKLEKVSASIFDMKIALDIPCLYKIVHCSTLVNGSCDTLCKDVG-VSNVDGVQRLVVGDD 628
            MKT+  T +  L+ A  +K     +  + + P+LD  G+++ +  +YY++S++ G   GGG++  +     CP  V+Q       G  +     D+   +VR ST++ ++F  +   + C+  ++W++DN + S GK ++T    K      T  ++FK+EK                 YK   C ++ + SC TLC D+G  S+ DG  RL + D+
Sbjct:    1 MKTA--TAVVLLLFAFTSKSYFFGVANAANSPVLDTDGDELQTGVQYYVLSSISGA-GGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPIRD-RLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGV------------LGYKFRFCPSVCD-SCTTLCSDIGRHSDDDGQIRLALSDN 200          
BLAST of BQ623054 vs. ExPASy Swiss-Prot
Match: SPOR1_IPOBA (Sporamin A OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.173e-11
Identity = 49/144 (34.03%), Postives = 77/144 (53.47%), Query Frame = 2
Query:   80 ASESEPILDVYGNQVDSSHRYYLVSALWGVKTGGGISADKGKNGQCPTDVIQLSPKD-KRGKNLGLLPY---DNSTIVRESTNIKLKFSRVSSLQQCNKDSLWKVDNDNASLGKQFITIGE-GKTCQNFFKLEKVSASIFDMKI 496
            AS   P+LD+ G++V +   YY+VSA+WG   GG   A      +C TDVI +SP D   G  + + P      ST+V  ST    +F+ +++ + C  +  W + +D+AS G+ F+  GE      N FK+E V A++   K+
Sbjct:   37 ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSKCATDVI-VSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSAS-GQYFLKAGEFVSDNSNQFKIELVDANLNSYKL 177          
The following BLAST results are available for this feature:
BLAST of BQ623054 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
MIRA_RICDU1.054e-1431.08Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
ASP_THECC1.682e-1227.1921 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
SPOR1_IPOBA3.173e-1134.03Sporamin A OS=Ipomoea batatas PE=2 SV=1[more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00145 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00145 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623054 ID=BQ623054|Name=BQ623054|organism=Citrus sinensis|type=EST|length=637bp
AAAAAAACAAATGAAGACTTCATTAGTAACAACACTCTCCTTCCTTATAC
TTGCTTTGGCCACAAAACCTCAGTTGGGCGCCTCAGAATCTGAACCTATC
TTAGATGTCTATGGCAACCAGGTGGACTCCAGCCACAGGTATTATCTTGT
CTCAGCACTCTGGGGAGTTAAAACCGGCGGTGGAATTAGCGCGGACAAAG
GCAAAAATGGACAGTGTCCAACGGATGTTATCCAATTAAGTCCTAAGGAC
AAAAGGGGAAAGAATTTAGGTTTACTTCCGTATGACAATTCCACAATTGT
CCGGGAATCCACTAATATTAAATTGAAATTCTCAAGAGTTTCTTCTCTTC
AGCAGTGTAACAAAGATTCGTTGTGGAAAGTTGACAACGATAACGCTTCA
TTAGGAAAGCAGTTTATAACAATCGGTGAAGGTAAAACGTGTCAAAATTT
TTTTAAACTTGAGAAAGTTAGTGCATCAATATTTGATATGAAAATAGCAC
TAGACATTCCCTGTCTATACAAAATTGTTCATTGTTCAACACTTGTTAAT
GGTTCTTGCGATACACTCTGCAAAGACGTTGGCGTTTCTAATGTGGATGG
CGTCCAACGTCTAGTTGTGGGTGATGATAATGATCAG
back to top