BQ623056

Overview
NameBQ623056
Unique NameBQ623056
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length642
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623056_ssr384 microsatellite BQ623056_ssr384:384..395. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP13_ARATH (Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3 PE=1 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 8.566e-73
Identity = 138/190 (72.63%), Postives = 156/190 (82.11%), Query Frame = 2
Query:   53 IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            IAIG P E  +PDA+RAA AEFFSMVIFVFAGQGSGMAY KLT +G  TPAGLV+AS++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+IT +R+ILYWIAQLLG+VVACLLLK STGG+ET+AF+LS GV  WNAVVFEIVMTFGLVYT YATAVDPK+G+            VG    +GG   G
Sbjct:    6 IAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVAASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDG 195          
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP12_ORYSJ (Probable aquaporin TIP1-2 OS=Oryza sativa subsp. japonica GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 6.787e-70
Identity = 130/190 (68.42%), Postives = 152/190 (80.00%), Query Frame = 2
Query:   53 IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            IA+G P E+  PD  +AAVAEF SM+IFVFAG GSGMA+SKLTD G TTP+GL++AS+AHA ALFVAV+VGANISGGHVNPAVTFGAFVGG+I+ V++++YW+AQLLGSVVACLLLK +TGG    AF+LS+GVGAWNAVVFEIVMTFGLVYT YATAVDPK+G+            VG     GG   G
Sbjct:    6 IAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTPSGLIAASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLLLKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDG 195          
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP11_ARATH (Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1 PE=1 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.672e-68
Identity = 131/190 (68.95%), Postives = 150/190 (78.95%), Query Frame = 2
Query:   53 IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            IAIG P E  +PDAL+AA+AEF S +IFV AG GSGMA++KLT+NGATTP+GLV+A++AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+IT +R ILYWIAQLLGSVVACL+LKF+TGGL   AF LS+GVG  NA VFEIVMTFGLVYT YATA+DPK G+            VG     GG   G
Sbjct:    6 IAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSG 195          
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP12_MAIZE (Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 9.173e-67
Identity = 127/190 (66.84%), Postives = 149/190 (78.42%), Query Frame = 2
Query:   53 IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            IA+G P E+  PD  +AAVAEF S +IFVFAG GSGMA+SKLTD GA TPAGL++AS+AHA ALFVAVSVGANISGGHVNPAVTFGAFVGG+I+ +++++YW+AQLLGSVVACLLLK +TGG    AF+LS+GVGA NAVV E+VMTFGLVYT YATAVDPK+G+            VG     GG   G
Sbjct:    6 IAVGAPGELSHPDTAKAAVAEFISTLIFVFAGSGSGMAFSKLTDGGAATPAGLIAASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLLLKIATGGAALGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDG 195          
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP11_ORYSJ (Probable aquaporin TIP1-1 OS=Oryza sativa subsp. japonica GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.014e-65
Identity = 128/190 (67.37%), Postives = 147/190 (77.37%), Query Frame = 2
Query:   53 IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            IA+G+  E+  P AL+AA+AEF S +IFVFAGQGSGMA+SKLT  GATTPAGL++A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R +LYWIAQLLGS VAC LL+FSTGGL T  F L +GV  W A+V EIVMTFGLVYT YATAVDPK+G+            VG    +GG   G
Sbjct:    6 IAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIAAAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFLLRFSTGGLATGTFGL-TGVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDG 194          
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP11_MAIZE (Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 5.565e-64
Identity = 125/190 (65.79%), Postives = 144/190 (75.79%), Query Frame = 2
Query:   53 IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            IA+G+  E+  P AL+AA AEF S +IFVFAGQGSGMA+SKLT  G TTPAGL++A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R +LYW+AQLLGS VAC LL+FSTGG  T  F L +GV  W A+V EIVMTFGLVYT YATAVDPK+G+            VG    +GG   G
Sbjct:    6 IALGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGPTTPAGLIAAAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFLLRFSTGGQATGTFGL-TGVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDG 194          
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP12_ARATH (Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2 PE=1 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 1.240e-63
Identity = 126/191 (65.97%), Postives = 146/191 (76.44%), Query Frame = 2
Query:   53 IAIGN-PAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            IAIG    E+  P+ALRAA+AEF S +IFVFAG GSG+A++K+TDNGATTP+GLV+A++AHAF LFVAVSVGANISGGHVNPAVTFG  +GG+IT +R ILYWIAQLLGSV AC LL F+TGG    AF LS+GVG+ NA+VFEIVMTFGLVYT YATAVDPK G+            VG     GG   G
Sbjct:    6 IAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSG 196          
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP1_MEDTR (Probable aquaporin TIP-type OS=Medicago truncatula GN=AQP1 PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 3.733e-60
Identity = 124/190 (65.26%), Postives = 139/190 (73.16%), Query Frame = 2
Query:   53 IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            IA+G P E   PD L+A +AEF S  IFVFAG GSG+AY+KLT++GA TPAGL+SASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT +R I+Y IAQLLGS+VA  LL F T      AF LS GVG   A+V EIVMTFGLVYT YATAVDPK+GN            VG    +GG   G
Sbjct:    6 IAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSIVASALLVFVTAS-SVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTG 194          
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP1_MEDSA (Probable aquaporin TIP-type OS=Medicago sativa GN=MCP1 PE=2 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 1.017e-57
Identity = 122/190 (64.21%), Postives = 137/190 (72.11%), Query Frame = 2
Query:   53 IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            IA+G P E   PD L+A +AEF S  IFVFAG GSG+AY+KLT++GA TPAGL+SASIAHAFALFVAVSVGANISGGHVNPAV FGAFVGG+IT +R I+Y IAQLLGS+V   LL F T      AF LS GVG   A+V EIVMTFGLVYT YATAVDPK+GN            VG    +GG   G
Sbjct:    6 IAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAHAFALFVAVSVGANISGGHVNPAV-FGAFVGGNITLLRGIVYIIAQLLGSIVCSALLVFVTAS-SVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTG 193          
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Match: TIP31_ARATH (Aquaporin TIP3-1 OS=Arabidopsis thaliana GN=TIP3-1 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 7.802e-50
Identity = 98/192 (51.04%), Postives = 126/192 (65.62%), Query Frame = 2
Query:   62 GNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKL-----TDNGATTPAGLVSASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTGYATAVDPKRGNXXXXXXXXXXXXVGPTSWLGGPLMG 622
            G   E   PD++RA +AEF S  +FVFA +GS ++  KL        G  TP GL+  ++AHAFALF AVS   N+SGGHVNPAVTFGA VGG +T +R+I YWIAQLLG+++ACLLL+ +T G+    F L+SGVGA N +V EI++TFGLVY  Y+T +DPKRG+            VG    +GGP  G
Sbjct:   12 GRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKLYWEHAAHAGTNTPGGLILVALAHAFALFAAVSAAINVSGGHVNPAVTFGALVGGRVTAIRAIYYWIAQLLGAILACLLLRLTTNGMRPVGFRLASGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLAIGLIVGANILVGGPFSG 203          
The following BLAST results are available for this feature:
BLAST of BQ623056 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 130
Match NameE-valueIdentityDescription
TIP13_ARATH8.566e-7372.63Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3... [more]
TIP12_ORYSJ6.787e-7068.42Probable aquaporin TIP1-2 OS=Oryza sativa subsp. j... [more]
TIP11_ARATH1.672e-6868.95Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1... [more]
TIP12_MAIZE9.173e-6766.84Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1[more]
TIP11_ORYSJ1.014e-6567.37Probable aquaporin TIP1-1 OS=Oryza sativa subsp. j... [more]
TIP11_MAIZE5.565e-6465.79Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1[more]
TIP12_ARATH1.240e-6365.97Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2... [more]
TIP1_MEDTR3.733e-6065.26Probable aquaporin TIP-type OS=Medicago truncatula... [more]
TIP1_MEDSA1.017e-5764.21Probable aquaporin TIP-type OS=Medicago sativa GN=... [more]
TIP31_ARATH7.802e-5051.04Aquaporin TIP3-1 OS=Arabidopsis thaliana GN=TIP3-1... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00147 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00147 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623056 ID=BQ623056|Name=BQ623056|organism=Citrus sinensis|type=EST|length=642bp
AGAGCTCGAAGCTAAAACTAAAACTTGCCAAGAAAATTAAAAAATGCCCG
GAATTGCTATCGGAAACCCGGCTGAGATCGGCCAGCCCGATGCCCTTAGG
GCGGCTGTCGCTGAGTTTTTCTCCATGGTCATTTTTGTTTTTGCCGGCCA
AGGGTCTGGCATGGCTTACAGCAAGCTCACGGACAATGGAGCAACAACAC
CAGCAGGTCTAGTGTCAGCATCAATAGCTCATGCATTTGCCCTCTTCGTG
GCAGTTTCTGTTGGCGCCAACATCTCCGGTGGACACGTGAACCCCGCTGT
TACTTTCGGTGCCTTTGTTGGCGGCCACATTACATTTGTCAGGAGTATTT
TGTACTGGATTGCCCAGTTACTCGGATCTGTTGTTGCTTGCTTGCTTCTC
AAGTTCTCCACTGGTGGATTGGAAACATCTGCTTTTGCCCTGTCATCTGG
AGTTGGTGCATGGAATGCAGTTGTGTTTGAGATTGTGATGACCTTTGGAC
TGGTCTACACGGGGTATGCCACAGCTGTTGACCCAAAGAGGGGAAACATT
GGCATCATTGCACCAATTGCAATTGGGTTATTGGTGGGGCCCACATCTTG
GCTGGGGGGGCCTTTGATGGGGCATCGATGACCCCTGAGTTT
back to top