BQ623088

Overview
NameBQ623088
Unique NameBQ623088
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length608
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: AHM1_ARATH (Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic OS=Arabidopsis thaliana GN=HMA1 PE=1 SV=2)

HSP 1 Score: 325.479 bits (833), Expect = 1.316e-88
Identity = 163/202 (80.69%), Postives = 185/202 (91.58%), Query Frame = 1
Query:    1 GTTHPIGRAVVDHSIGKDLPSVSIDRFEYFPGRGLTATVNGIESGTEGGKELKASLGSVDFITSLCKSEDESRKIKEAVNASSYGRGFVHAALSVNEKVTLIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVLAQRASA 606
            GTTHPIGRAVVDHS+GKDLPS+ ++ FEYFPGRGLTATVNG+++  E  +  KASLGS++FITSL KSEDES++IK+AVNASSYG+ FVHAALSV++KVTLIHLED+PRPGVS VIAELK  ARLRVMMLTGDH+SSA RVANAVGI EVYC+LKPEDKLNHVK+ +R+ GGGLIMVGEGINDAPALAAATVGIVLAQRASA
Sbjct:  504 GTTHPIGRAVVDHSVGKDLPSIFVESFEYFPGRGLTATVNGVKTVAEESRLRKASLGSIEFITSLFKSEDESKQIKDAVNASSYGKDFVHAALSVDQKVTLIHLEDQPRPGVSGVIAELKSWARLRVMMLTGDHDSSAWRVANAVGITEVYCNLKPEDKLNHVKNIAREAGGGLIMVGEGINDAPALAAATVGIVLAQRASA 705          
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: CADA1_LISMO (Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.298e-19
Identity = 60/195 (30.77%), Postives = 99/195 (50.77%), Query Frame = 1
Query:   10 HPIGRAVVDHSI--GKDLPSVSIDRFEYFPGRGLTATVNGIESGTEGGKELKASLGSVDFITSLCKSEDESRKIKEAVNASSYGRGFVHAALSVNEKVTLIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVL 588
            HP+  A++  ++    D  S+ ID F    G+G+   VNGI       K  ++SL     I+   +S       K+   A  +G        + +  + +I + D  R    +VIA+L        +MLTGD+  +AQ +   +G++++   L PEDKL ++K   +   G + M+G+G+NDAPALAA+TVGI +
Sbjct:  438 HPLASAIISKAMIDNVDYKSIEIDNFSSITGKGVKGEVNGITYYIGSSKLFESSLEKSQSISQTYQSLQ-----KQGKTAMLFG--------TESNILAIIAVADEVRESSKEVIAQLHKLGIAHTIMLTGDNNDTAQFIGKEIGVSDIKAELMPEDKLTYIKELKQTY-GKVAMIGDGVNDAPALAASTVGIAM 618          
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: CADA2_LISMO (Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.449e-18
Identity = 60/196 (30.61%), Postives = 104/196 (53.06%), Query Frame = 1
Query:   10 HPIGRAVVDHSIGK--DLPSVSIDRFEYFPGRGLTATVNGIESGTEGGKELKASLGSVDFITSLCKSEDESRKIKEAVNASSYGRGFVHAALSVNEK-VTLIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVL 588
            HP+  A++ +   +  DL S++++ F    G+G+  TV+G  +   G   L   L +  F  S+ +   + +            +G        N+K ++++ + D  R     VI  L +    + +MLTGD++++AQ +   VG++E+   L P+DKL+++K    +  G + MVG+GINDAPALAAATVGI +
Sbjct:  440 HPLASAIIKYGETREMDLTSINVNDFTSITGKGIRGTVDG-NTYYVGSPVLFKELLASQFTDSIHRQVSDLQL-----------KGKTAMLFGTNQKLISIVAVADEVRSSSQHVIKRLHELGIEKTIMLTGDNQATAQAIGQQVGVSEIEGELMPQDKLDYIKQLKINF-GKVAMVGDGINDAPALAAATVGIAM 622          
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: COPA_STAS1 (Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.877e-17
Identity = 58/197 (29.44%), Postives = 103/197 (52.28%), Query Frame = 1
Query:    1 GTTHPIGRAVVDHSIGKDLPSVSIDRFEYFPGRGLTATVNGIESGTEGGKELKASLGSVDFITSLCKSEDESRKIKEAVNASSYGRGFVHAALSVNEKVT-LIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVL 588
            G+ HP+  A+V+++   ++  +    FE  PGRG+ A ++G        K L   +G+  F+      E+   K  E +       G     +++N++   ++ + D  +   +  I +L D   ++V+MLTGD+E +AQ +AN VGI+ +   + PE+K   +KS  +     + MVG+G+NDAPAL  A +GI +
Sbjct:  526 GSEHPLADAIVNYAQTMNIKLLDTTDFEAVPGRGIKANISG--------KNL--IVGNRQFMND----ENVDIKDSEDIMTQFEKSGKTAMLIAINQEYRGMVAVADTVKDSTATAIKQLHD-LNIKVVMLTGDNERTAQAIANEVGIDTIIAQVLPEEKAAKIKSL-QTQDKTIAMVGDGVNDAPALVQADIGIAI 706          
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: ATCU_RHILV (Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.709e-16
Identity = 64/200 (32.00%), Postives = 97/200 (48.50%), Query Frame = 1
Query:    1 GTTHPIGRAVVDHSIGKDLPSVSIDRFEYFPGRGLTATVNGIESGTEGGKELKASLGSVDFITSLCKSEDESRKIKEAVNASSYGRGFVHAALSVNEKVTLIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVLAQRA 600
            G+ HP+  A+V  +  + +P V +  FE   G+G    V GI  GT        +LG+   +  L        +  EA+        FV   +       L+ + DR +P  +  I  L D   L+++M TGD+E +A+ VA ++GI+EV   + PE K   +    R  G  + M G+G+NDAPALAAA VGI +   A
Sbjct:  566 GSEHPLAEAIVSGAEERGVPFVEVTGFEAKTGKG----VQGIADGT------MVALGNSAMLADLGIDPAALSEKTEALRGDGKTVMFV---VFDGALAGLVAVADRIKPTTAAAIQALHDSG-LKIIMATGDNERTARAVAKSLGIDEVRADVLPEGKKALIDEL-RSKGAIIAMAGDGVNDAPALAAADVGIAMGTGA 750          
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: CTPC_MYCTU (Probable cation-transporting P-type ATPase C OS=Mycobacterium tuberculosis GN=ctpC PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.940e-15
Identity = 47/98 (47.96%), Postives = 64/98 (65.31%), Query Frame = 1
Query:  295 VTLIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVL 588
            V LI L D  RP  + V+ +L+ +   R++MLTGDH   AQ VA+ +GI+E    + PEDKL  V+   +D G  + MVG+GINDAPALAAA +GI +
Sbjct:  531 VGLISLRDEVRPEAAQVLTKLRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVREL-QDDGYVVGMVGDGINDAPALAAADIGIAM 627          
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: CTPC_MYCBO (Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis GN=ctpC PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.940e-15
Identity = 47/98 (47.96%), Postives = 64/98 (65.31%), Query Frame = 1
Query:  295 VTLIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVL 588
            V LI L D  RP  + V+ +L+ +   R++MLTGDH   AQ VA+ +GI+E    + PEDKL  V+   +D G  + MVG+GINDAPALAAA +GI +
Sbjct:  531 VGLISLRDEVRPEAAQVLTKLRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVREL-QDDGYVVGMVGDGINDAPALAAADIGIAM 627          
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: COPA_STAES (Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.940e-15
Identity = 60/198 (30.30%), Postives = 103/198 (52.02%), Query Frame = 1
Query:   10 HPIGRAVVDHSIGKDLPSVSIDRFEYFPGRGLTATVNGIESGTEGGKELKASLGSVDFITSLCKSEDESRKIKEAVNASSYGRGFVHAALSVNEKVT-LIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVLAQRA 600
            HP+  A+V ++  K L  +  D F+  PG G+ AT++  +    G ++L       D+  S+      S K+ + +N   +  G     ++V+ ++  +I + D  +      I EL++   + V+MLTGD+  +AQ +A  VGI  V   + PE+K + + S  +D G  + MVG+GINDAPAL  A +G+ +   A
Sbjct:  528 HPLADAIVTYAKDKGLNLLDNDTFKSIPGHGIKATIHQ-QQILVGNRKLMN-----DYNISI------SNKLNDQLNHYEH-LGQTAMMIAVDNQINGIIAVADTVKNDAKQAIKELRN-MNIDVVMLTGDNNRTAQTIAKQVGIEHVIAEVLPEEKAHQI-SLLQDKGKQVAMVGDGINDAPALVKADIGMAIGTGA 710          
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: COPA_STAEQ (Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.940e-15
Identity = 60/198 (30.30%), Postives = 103/198 (52.02%), Query Frame = 1
Query:   10 HPIGRAVVDHSIGKDLPSVSIDRFEYFPGRGLTATVNGIESGTEGGKELKASLGSVDFITSLCKSEDESRKIKEAVNASSYGRGFVHAALSVNEKVT-LIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVLAQRA 600
            HP+  A+V ++  K L  +  D F+  PG G+ AT++  +    G ++L       D+  S+      S K+ + +N   +  G     ++V+ ++  +I + D  +      I EL++   + V+MLTGD+  +AQ +A  VGI  V   + PE+K + + S  +D G  + MVG+GINDAPAL  A +G+ +   A
Sbjct:  528 HPLADAIVTYAKDKGLNLLDNDTFKSIPGHGIKATIHQ-QQILVGNRKLMN-----DYNISI------SNKLNDQLNHYEH-LGQTAMMIAVDNQINGIIAVADTVKNDAKQAIKELRN-MNIDVVMLTGDNNRTAQTIAKQVGIEHVIAEVLPEEKAHQI-SLLQDKGKQVAMVGDGINDAPALVKADIGMAIGTGA 710          
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Match: ATCS_SYNE7 (Cation-transporting ATPase pacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 1.940e-15
Identity = 61/195 (31.28%), Postives = 96/195 (49.23%), Query Frame = 1
Query:   10 HPIGRAVVDHSIGKDLPSVSIDRFEYFPGRGLTATVNGI--ESGTEGGKELKASLGSVDFITSLCKSEDESRKIKEAVNASSYGRGFVHAALSVNEKVTLIHLEDRPRPGVSDVIAELKDHARLRVMMLTGDHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATVGIVL 588
            HP+  A+V +   + +   ++  FE  PG G+   V GI  + GT+        LG +   TS  +++ E  +            G + A LS+          D+ +P    V+  L+    L+V+MLTGD+  +A  +A AVGI +V   ++P+ K   V +  +  G  + MVG+GINDAPALA A VGI +
Sbjct:  474 HPLAEAIVRYGEAQGITLSTVTDFEAIPGSGVQGQVEGIWLQIGTQRW------LGELGIETSALQNQWEDWEAAGKTVVGVAADGHLQAILSI---------ADQLKPSSVAVVRSLQ-RLGLQVVMLTGDNRRTADAIAQAVGITQVLAEVRPDQKAAQV-AQLQSRGQVVAMVGDGINDAPALAQADVGIAI 651          
The following BLAST results are available for this feature:
BLAST of BQ623088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 93
Match NameE-valueIdentityDescription
AHM1_ARATH1.316e-8880.69Probable cadmium/zinc-transporting ATPase HMA1, ch... [more]
CADA1_LISMO1.298e-1930.77Probable cadmium-transporting ATPase OS=Listeria m... [more]
CADA2_LISMO2.449e-1830.61Probable cadmium-transporting ATPase OS=Listeria m... [more]
COPA_STAS17.877e-1729.44Copper-exporting P-type ATPase A OS=Staphylococcus... [more]
ATCU_RHILV8.709e-1632.00Copper-transporting P-type ATPase OS=Rhizobium leg... [more]
CTPC_MYCTU1.940e-1547.96Probable cation-transporting P-type ATPase C OS=My... [more]
CTPC_MYCBO1.940e-1547.96Probable cation-transporting P-type ATPase C OS=My... [more]
COPA_STAES1.940e-1530.30Copper-exporting P-type ATPase A OS=Staphylococcus... [more]
COPA_STAEQ1.940e-1530.30Copper-exporting P-type ATPase A OS=Staphylococcus... [more]
ATCS_SYNE71.940e-1531.28Cation-transporting ATPase pacS OS=Synechococcus e... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00179 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00179 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623088 ID=BQ623088|Name=BQ623088|organism=Citrus sinensis|type=EST|length=608bp
GGTACTACCCACCCTATTGGAAGAGCTGTGGTTGACCATAGTATAGGCAA
GGACCTTCCTTCTGTATCAATTGACCGTTTTGAGTATTTTCCTGGTCGAG
GTCTCACAGCAACTGTAAATGGCATTGAGTCAGGAACTGAAGGGGGTAAA
GAATTGAAAGCATCTCTGGGTTCTGTAGATTTTATAACTTCTCTCTGTAA
ATCTGAAGATGAATCAAGAAAGATCAAGGAAGCTGTGAATGCTTCTTCTT
ATGGAAGGGGCTTTGTTCATGCTGCTCTTTCTGTTAATGAAAAGGTAACA
TTGATTCACCTCGAGGATAGGCCTCGCCCAGGAGTTTCAGATGTTATAGC
AGAATTAAAAGATCATGCAAGATTACGTGTGATGATGTTAACTGGTGACC
ATGAGTCTAGTGCGCAGAGAGTAGCAAATGCTGTTGGCATCAATGAAGTT
TACTGCAGCCTGAAGCCTGAGGATAAGCTCAATCATGTGAAGAGTACCTC
CAGGGATATGGGAGGAGGTTTGATCATGGTTGGTGAAGGCATTAATGATG
CGCCAGCACTCGCAGCTGCAACTGTGGGAATTGTTCTTGCTCAACGGGCT
AGTGCAAC
back to top