BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C16B1_PICSI (Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.897e-55
Identity = 90/184 (48.91%), Postives = 134/184 (72.83%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISP 549
            T+S  + +  K LA++P CY  +L+E +NI  +K  G++L  ED++++KY+W+VA+E++RLFP + GSFRKA+ +  Y+GFTIPKGWK+ WT   TH   EYF +P  FDP RFE E  PPY ++PFGGGPR+C G + A++ I+IF+H +V  ++W+L+NP E + +DP+P P  G+PIK+ P
Sbjct:  308 TSSSTLTVLLKFLAENPHCYEEVLREQLNIAGSKEEGQLLEWEDLQRMKYSWRVAQEALRLFPAVQGSFRKAIKEFIYDGFTIPKGWKLHWTVNSTHQKSEYFSNPEKFDPSRFEGEGPPPYTFVPFGGGPRMCPGNEFARMEILIFLHNIVKNFNWNLVNPLEKVIVDPMPAPVNGLPIKLVP 491          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C16B2_PICSI (Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 7.208e-55
Identity = 90/184 (48.91%), Postives = 133/184 (72.28%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISP 549
            T+S  + +  K LA++P CY  +L+E ++I  +K AG++L  ED++++KY+W+VA+E++RLFP   GSFRKA+ +  Y+GFTIPKGWK+ WT   TH   EYF +P +FDP RFE E  PPY ++PFGGGPR+C G + A+L I++F+H +V    W+L+NP E + +DP+P P  G+PIK+ P
Sbjct:  308 TSSSTLTVLLKFLAENPHCYEEVLREQLDIAGSKEAGQLLEWEDLQRMKYSWRVAQEALRLFPAAQGSFRKAIKEFIYDGFTIPKGWKMYWTVNSTHRKSEYFSNPETFDPSRFEGEGPPPYTFVPFGGGPRMCPGNEFARLEILVFLHNIVKNCKWNLVNPGEKVIVDPMPAPVNGLPIKLVP 491          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: T5H_TAXCU (Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata PE=1 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 6.102e-54
Identity = 91/189 (48.15%), Postives = 141/189 (74.60%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES---VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY-DWSLINPNESITMDPL-PFPSQGMPIKISPK 552
            TT+  +A+ FK+L+ +P+CY  ++QE + I++NK  GE +T +D+K +KYTWQVA+E++R+FPP+FG+FRKA++DI+Y+G+TIPKGWK+LWT + TH    YF +P  F P RF++    V PY +LPFGGG R C G++ +K+ I++FVH+ V  +  ++ ++P+E I+ DPL P PS+G  IK+ P+
Sbjct:  310 TTTSPMALIFKLLSSNPECYQKVVQEQLEILSNKEEGEEITWKDLKAMKYTWQVAQETLRMFPPVFGTFRKAITDIQYDGYTIPKGWKLLWTTYSTHPKDLYFNEPEKFMPSRFDQEGKHVAPYTFLPFGGGQRSCVGWEFSKMEILLFVHHFVKTFSSYTPVDPDEKISGDPLPPLPSKGFSIKLFPR 498          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: T13H_TAXCU (Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 5.910e-49
Identity = 87/186 (46.77%), Postives = 128/186 (68.82%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES---VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD-WSLINPNESITMDPL-PFPSQGMPIKI 543
            +T+  + M  K+LA HP+ Y  + QE   I++ K  GE +  +D+K++KY+WQV +E++R++PPIFG+FRKA++DI Y G+TIPKGWK+LWT + T +  EYF+D   F P RFEE    V PY YLPFGGG R+C G++ AK+  ++F+H+ V  +     I+PNE ++  PL P P  G+PIK+
Sbjct:  296 STNSPLTMLIKVLASHPESYEKVAQEQFGILSTKMEGEEIAWKDLKEMKYSWQVVQETLRMYPPIFGTFRKAITDIHYNGYTIPKGWKLLWTTYSTQTKEEYFKDADQFKPSRFEEEGKHVTPYTYLPFGGGMRVCPGWEFAKMETLLFLHHFVKAFSGLKAIDPNEKLSGKPLPPLPVNGLPIKL 481          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: T10H_TAXCU (Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 6.534e-48
Identity = 85/189 (44.97%), Postives = 130/189 (68.78%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES---VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY-DWSLINPNESITMDPL-PFPSQGMPIKISPK 552
            TT   +A+ FK+L  +P+ +  + QE + I+ NK+ GE ++ +D+K +KYTWQ  +ES+R++PP+FG FRKA++DI Y+G+TIPKGW+VL + + TH   EYF +P  F P RFE+    V PY Y+PFGGG R C G++ +K+ I++FVH+ V  +  +  ++PNE +  DPL P P+ G  IK+ P+
Sbjct:  308 TTVAPMALIFKLLYSNPEYHEKVFQEQLEIIGNKKEGEEISWKDLKSMKYTWQAVQESLRMYPPVFGIFRKAITDIHYDGYTIPKGWRVLCSPYTTHLREEYFPEPEEFRPSRFEDEGRHVTPYTYVPFGGGLRTCPGWEFSKIEILLFVHHFVKNFSSYIPVDPNEKVLSDPLPPLPANGFSIKLFPR 496          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH3_ARATH (Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 3.594e-38
Identity = 74/184 (40.22%), Postives = 109/184 (59.24%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            TT+  +    K LA +P     + +E + I  +K+ GE LT ED KK+  T++V +E++R    +  +FR+AV D+EYEG+ IPKGWKVL      H N + F DP  FDP RFE +  P  ++PFG G   C G +LAKL I + +H++ T+Y WS++ P++ I   P   P  G+PI +  K
Sbjct:  279 TTASVLTWILKYLADNPTVLEAVTEEQMAIRKDKKEGESLTWEDTKKMPLTYRVIQETLRAATILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHNADIFSDPGKFDPSRFEVAPKPNTFMPFGSGIHSCPGNELAKLEISVLIHHLTTKYRWSIVGPSDGIQYGPFALPQNGLPIALERK 462          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH1_ARATH (Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.180e-35
Identity = 70/184 (38.04%), Postives = 110/184 (59.78%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            TT+  ++   K LA++P+    + +E + I  +K  GE LT  D KK+  T +V +E++R+   +  +FR+AV D+EYEG+ IPKGWKVL      H + + F +P  FDP RFE +  P  ++PFG G   C G +LAKL + I +H++ T+Y WS++  ++ I   P   P  G+PI ++ K
Sbjct:  279 TTASVMSWILKYLAENPNVLEAVTEEQMAIRKDKEEGESLTWGDTKKMPLTSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSADIFSNPGKFDPSRFEVAPKPNTFMPFGNGTHSCPGNELAKLEMSIMIHHLTTKYSWSIVGASDGIQYGPFALPQNGLPIVLARK 462          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH2_ARATH (Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.719e-35
Identity = 70/184 (38.04%), Postives = 108/184 (58.70%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNN-KRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISP 549
            TT+  +    K L  HP+    + +E  +I    K+    ++ ED +K+  T +V +E++R    +  +FR+AV D+EY+G+ IPKGWKVL      H + E+F DP  FDP RFE +  PY Y+PFG G   C G +LAKL ++I +H++ T + W +I   E I   P P P +G+PI+++P
Sbjct:  298 TTASVLTWLLKYLHDHPNLLQEVSREQFSIRQKIKKENRRISWEDTRKMPLTTRVIQETLRAASVLSFTFREAVQDVEYDGYLIPKGWKVLPLFRRIHHSSEFFPDPEKFDPSRFEVAPKPYTYMPFGNGVHSCPGSELAKLEMLILLHHLTTSFRWEVIGDEEGIQYGPFPVPKKGLPIRVTP 481          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH1_ORYSJ (Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP707A5 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.481e-33
Identity = 68/185 (36.76%), Postives = 103/185 (55.68%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRA-GEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            TT+  +    K L  HP     + +E + I   K A GE L+  D +++K T +V +E+MR+   +  +FR+AV D+EY+G+ IPKGWKVL      H NP++F  P  FDP RFE +  P  ++PFG G   C G +LAKL +++  H++ T+Y WS       +   P   P  G+P+  + K
Sbjct:  282 TTASVLTWMVKFLGDHPAVLKAVTEEQLQIAKEKEASGEPLSWADTRRMKMTSRVIQETMRVASILSFTFREAVEDVEYQGYLIPKGWKVLPLFRNIHHNPDHFPCPEKFDPSRFEVAPKPNTFMPFGNGTHSCPGNELAKLEMLVLFHHLATKYRWSTSKSESGVQFGPFALPLNGLPMSFTRK 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH1_ORYSI (Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. indica GN=CYP707A5 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.481e-33
Identity = 68/185 (36.76%), Postives = 103/185 (55.68%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRA-GEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            TT+  +    K L  HP     + +E + I   K A GE L+  D +++K T +V +E+MR+   +  +FR+AV D+EY+G+ IPKGWKVL      H NP++F  P  FDP RFE +  P  ++PFG G   C G +LAKL +++  H++ T+Y WS       +   P   P  G+P+  + K
Sbjct:  282 TTASVLTWMVKFLGDHPAVLKAVTEEQLQIAKEKEASGEPLSWADTRRMKMTSRVIQETMRVASILSFTFREAVEDVEYQGYLIPKGWKVLPLFRNIHHNPDHFPCPEKFDPSRFEVAPKPNTFMPFGNGTHSCPGNELAKLEMLVLFHHLATKYRWSTSKSESGVQFGPFALPLNGLPMSFTRK 466          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C16B1_PICSI1.897e-5548.91Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP71... [more]
C16B2_PICSI7.208e-5548.91Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP71... [more]
T5H_TAXCU6.102e-5448.15Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata P... [more]
T13H_TAXCU5.910e-4946.77Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=... [more]
T10H_TAXCU6.534e-4844.97Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=C... [more]
ABAH3_ARATH3.594e-3840.22Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thal... [more]
ABAH1_ARATH2.180e-3538.04Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thal... [more]
ABAH2_ARATH3.719e-3538.04Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thal... [more]
ABAH1_ORYSJ3.481e-3336.76Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa sub... [more]
ABAH1_ORYSI3.481e-3336.76Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa sub... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top