BQ623098

Overview
NameBQ623098
Unique NameBQ623098
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length611
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3096 contig Csv1_Contig3096:616..1227. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 2.525e-100
Identity = 148/158 (93.67%), Postives = 153/158 (96.84%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            ESWCQGLDGLASRS EYYKQGARFAKWRTVVS+PCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLA+NNV+ EGILLKPSMVTPGAEHK KASPET+A +TLTMLKRRVPPAVPGIMFLSGGQSE EA
Sbjct:  153 ESWCQGLDGLASRSAEYYKQGARFAKWRTVVSVPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAQNNVMFEGILLKPSMVTPGAEHKNKASPETVADFTLTMLKRRVPPAVPGIMFLSGGQSEAEA 310          

HSP 2 Score: 81.2629 bits (199), Expect = 2.525e-100
Identity = 35/44 (79.55%), Postives = 41/44 (93.18%), Query Frame = 2
Query:  476 STLNLNAMNQAPNPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +TLNLNAMNQ+PNPWHVSF YARALQN+VL+TWQG+PE  EA+Q
Sbjct:  310 ATLNLNAMNQSPNPWHVSFSYARALQNSVLRTWQGKPEKIEASQ 353          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 1.649e-90
Identity = 131/159 (82.39%), Postives = 147/159 (92.45%), Query Frame = 3
Query:    3 NESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            NESW QGLDGL+SR+  YY+QGARFAKWRTVVSIP GPSALAVKEAAWGLARYAAISQD+GLVPIVEPEILLDG+H I+RT +VAEKVW+EVFFYLA+NNV+ EGILLKPSMVTPGAE K++A+PE +A YTL +L+ RVPPAVPGIMFLSGGQSEVEA
Sbjct:  159 NESWGQGLDGLSSRTAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTYDVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVAAYTLKLLRNRVPPAVPGIMFLSGGQSEVEA 317          

HSP 2 Score: 83.9593 bits (206), Expect = 1.649e-90
Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 2
Query:  476 STLNLNAMNQAPNPWHVSFFYARALQNTVLKTWQGRPENTEAAQS 610
            +TLNLNAMNQAPNPWHVSF YARALQNT LKTW GRPEN  AAQ+
Sbjct:  317 ATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRPENVNAAQT 361          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 1.060e-89
Identity = 131/159 (82.39%), Postives = 145/159 (91.19%), Query Frame = 3
Query:    3 NESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            NESWCQGLDGLASR   YY+QGARFAKWRTVVSIP GPS LAVKEAAWGLARYAAISQDNGLVPIVEPEILLDG+H I+RT EVA+KVW+E FFY+AENNV+ EGILLKPSMVTPGAE K++A+PE ++ YTL +L RR+PPAVPGIMFLSGGQSEVEA
Sbjct:  149 NESWCQGLDGLASREAAYYQQGARFAKWRTVVSIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAETFFYMAENNVMFEGILLKPSMVTPGAECKDRATPEQVSDYTLKLLHRRIPPAVPGIMFLSGGQSEVEA 307          

HSP 2 Score: 78.5666 bits (192), Expect = 1.060e-89
Identity = 35/44 (79.55%), Postives = 38/44 (86.36%), Query Frame = 2
Query:  476 STLNLNAMNQAPNPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +T NLNAMNQ PNPWHVSF YARALQNT LKTW G+PEN +AAQ
Sbjct:  307 ATQNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGQPENVKAAQ 350          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 269.24 bits (687), Expect = 6.816e-89
Identity = 128/159 (80.50%), Postives = 147/159 (92.45%), Query Frame = 3
Query:    3 NESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            +ESWCQGLDGLASR+  YY+QGARFAKWRTVVSIP GPSALAVKEAAWGLARYAAISQD+GLVPIVEPEI+LDG+H I+RT +VAEKVW+EVFFYLA+NNV+ EGILLKPSMVTPGAE  ++A+PE +A YTL +L+ R+PPAVPGIMFLSGGQSE+EA
Sbjct:  160 DESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEIMLDGEHGIDRTYDVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAEATDRATPEQVASYTLKLLRNRIPPAVPGIMFLSGGQSELEA 318          

HSP 2 Score: 79.7221 bits (195), Expect = 6.816e-89
Identity = 36/44 (81.82%), Postives = 39/44 (88.64%), Query Frame = 2
Query:  476 STLNLNAMNQAPNPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +TLNLNAMNQAPNPWHVSF YARALQNT LKTW G+ EN +AAQ
Sbjct:  318 ATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGKEENVKAAQ 361          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 238.81 bits (608), Expect = 5.251e-77
Identity = 119/159 (74.84%), Postives = 132/159 (83.02%), Query Frame = 3
Query:    3 NESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            +ESWCQGLDGLA RS  YY+QGARFAKWRTVVSIP GPSALAVKEAAWGLARYAAI+QDNGL PI+EPEI+LDG+H I+RT  VA++VW+EVFF LAENNV+LEG  LKPSMV PGA    K  PE +A Y L +L RR  P VPGIM LSGGQSEVEA
Sbjct:  157 DESWCQGLDGLACRSAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAITQDNGLDPILEPEIMLDGEHGIDRTFRVAQQVWAEVFFNLAENNVLLEGSSLKPSMVGPGALSARKGPPEQVADYPLKLLHRRRGPVVPGIMVLSGGQSEVEA 315          

HSP 2 Score: 70.4774 bits (171), Expect = 5.251e-77
Identity = 32/42 (76.19%), Postives = 35/42 (83.33%), Query Frame = 2
Query:  476 STLNLNAMNQAPNPWHVSFFYARALQNTVLKTWQGRPENTEA 601
            +TLNLNAMNQ+PNPWHVSF YARALQNT LKTW    EN +A
Sbjct:  315 ATLNLNAMNQSPNPWHVSFSYARALQNTCLKTWVEGQENVKA 356          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 280.026 bits (715), Expect = 6.410e-75
Identity = 139/172 (80.81%), Postives = 150/172 (87.21%), Query Frame = 3
Query:    3 NESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEAH*T*MR*TKPPTP 518
            NESWCQGLDGLASRS  YY+QGARFAKWRTVVSIP GPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDG+H I+RT EVA+KVW+EVF+YLAENNV  EGILLKPSMVTPGAE K+KASP  +A+YTL +L RR+PPAVPGIMFLSGGQSEVEA        K P P
Sbjct:  111 NESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAEVFYYLAENNVQFEGILLKPSMVTPGAESKDKASPTKVAEYTLNLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNKSPNP 282          

HSP 2 Score: 78.9518 bits (193), Expect = 2.169e-14
Identity = 35/44 (79.55%), Postives = 39/44 (88.64%), Query Frame = 2
Query:  476 STLNLNAMNQAPNPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +TLNLNAMN++PNPWHVSF YARALQNT LKTW G PEN +AAQ
Sbjct:  269 ATLNLNAMNKSPNPWHVSFSYARALQNTALKTWGGLPENVKAAQ 312          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 2.436e-74
Identity = 138/172 (80.23%), Postives = 150/172 (87.21%), Query Frame = 3
Query:    3 NESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEAH*T*MR*TKPPTP 518
            +ESWCQGLDGLASRS  YY+QGARFAKWRTVVSIP GPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDG+H I+RT EVA+KVW+EVF+YLAENNV  EGILLKPSMVTPGAE K+KASP  +A+YTL +L RR+PPAVPGIMFLSGGQSEVEA        K P P
Sbjct:  117 DESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAEVFYYLAENNVQFEGILLKPSMVTPGAESKDKASPTKVAEYTLNLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNKSPNP 288          

HSP 2 Score: 78.9518 bits (193), Expect = 2.169e-14
Identity = 35/44 (79.55%), Postives = 39/44 (88.64%), Query Frame = 2
Query:  476 STLNLNAMNQAPNPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +TLNLNAMN++PNPWHVSF YARALQNT LKTW G PEN +AAQ
Sbjct:  275 ATLNLNAMNKSPNPWHVSFSYARALQNTALKTWGGLPENVKAAQ 318          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.471e-55
Identity = 96/159 (60.38%), Postives = 119/159 (74.84%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSI-PCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            E+  QGLDGLA R  +YY  GARFAKWR V+ I P  PS LA+ E A GLARY  I Q+NGLVPIVEPEIL+DG H I+R  EV+E+V +  +  L +++V+LEG  LKP++VTPG+E K K +PE IA+YT+  L+R VP AVPG+MFLSGGQSE EA
Sbjct:  117 ETTTQGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSERVLAACYKALNDHHVLLEGTSLKPNIVTPGSESK-KVTPEVIAEYTVRTLQRTVPQAVPGVMFLSGGQSEEEA 274          

HSP 2 Score: 54.6842 bits (130), Expect = 5.471e-55
Identity = 26/46 (56.52%), Postives = 31/46 (67.39%), Query Frame = 2
Query:  476 STLNLNAMN--QAPNPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +TLNLNAMN  +   PW +SF Y RALQ + LK WQG+ EN   AQ
Sbjct:  274 ATLNLNAMNKLETKKPWTLSFSYGRALQQSTLKAWQGKEENVAKAQ 319          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.389e-53
Identity = 112/201 (55.72%), Postives = 140/201 (69.65%), Query Frame = 3
Query:    9 SWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEAH*T*MR*TKPPTPGTCPFFMPVHFKTLFLKHGKVVLRILKLPKV 611
            SWC GLDG  S + EYYK GARFAKWR+VVSIP GPS + +   A+GLARYAAI+Q+ GLVPIVEPE+LLDG+H I+R LEV E +W+E F Y+A+N V+L+GILLKP+MVTPGA+ K KA P  +A+YTL ML  R PP VPGIMFLSGGQSE+E+        + P P    F          LK  +   R ++ P++
Sbjct:  139 SWCMGLDGWTS-AAEYYKAGARFAKWRSVVSIPHGPSIM-LPRLAYGLARYAAIAQNAGLVPIVEPEVLLDGEHDIDRCLEVQEAIWAETFKYMADNKVMLQGILLKPAMVTPGADCKNKAGPAKVAEYTLKMLAARAPP-VPGIMFLSGGQSELESTLNLNAMNQSPNPWHVSFSYARALTNTVLKTWQASPRTVQAPRL 336          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.962e-53
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCG---PSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            E+  QGLDGLA R  +YY+ GARFAKWR V+ I      PS L++ E A  LARYAAI Q+NGLVPIVEPEIL+DG+H +E++ EV EKV + VF  L +++++LEG LLKP+MV  G +   KA+ E I K+T+  L+R VPPA+ G++FLSGGQ+E+EA
Sbjct:  115 ETSTQGLDGLAERCKKYYEAGARFAKWRAVLKIDLAKNCPSQLSITENAHTLARYAAICQENGLVPIVEPEILMDGNHTVEQSAEVTEKVLAAVFKALNDHHILLEGALLKPNMVVNGTDCPIKATSEQIGKFTVRTLQRTVPPALTGVVFLSGGQTEIEA 275          

HSP 2 Score: 54.6842 bits (130), Expect = 4.962e-53
Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 2
Query:  476 STLNLNAMNQAPN-PWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +T NLNAMN  PN PW +SF Y RALQ +V+ TW+G   N EAA+
Sbjct:  275 ATANLNAMNVLPNRPWALSFSYGRALQASVISTWKGESANVEAAR 319          
The following BLAST results are available for this feature:
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALFC3_ARATH2.525e-10093.67Probable fructose-bisphosphate aldolase 3, chlorop... [more]
ALFC2_ARATH1.649e-9082.39Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALFC_ORYSJ1.060e-8982.39Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALFC1_ARATH6.816e-8980.50Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALFC_SPIOL5.251e-7774.84Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALFC2_PEA6.410e-7580.81Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALFC1_PEA2.436e-7480.23Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALF_SPIOL5.471e-5560.38Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALFC_CHLRE1.389e-5355.72Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALF_DICDI4.962e-5355.90Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00189 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00189 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623098 ID=BQ623098|Name=BQ623098|organism=Citrus sinensis|type=EST|length=611bp
ACAATGAATCGTGGTGCCAAGGCTTGGATGGATTGGCATCAAGATCCACT
GAATACTACAAGCAAGGTGCTCGATTTGCTAAGTGGAGGACAGTTGTTAG
CATTCCATGTGGTCCTTCTGCTCTGGCTGTGAAGGAAGCTGCATGGGGCC
TTGCACGATATGCTGCTATTTCTCAGGATAATGGACTTGTGCCTATAGTG
GAACCCGAGATCCTTCTTGATGGGGACCACCCAATTGAGAGGACCCTTGA
AGTGGCAGAAAAGGTCTGGTCAGAAGTCTTTTTCTACTTGGCAGAAAACA
ATGTCGTTCTTGAGGGAATTCTACTTAAACCCAGCATGGTCACGCCAGGT
GCTGAACACAAGGAGAAGGCCTCTCCAGAGACCATTGCTAAATATACACT
TACAATGCTCAAGAGGAGAGTACCCCCTGCAGTCCCAGGAATCATGTTTT
TGTCTGGAGGACAATCAGAAGTGGAAGCACATTGAACTTGAATGCGATGA
ACCAAGCCCCCAACCCCTGGCACGTGTCCTTTTTTTATGCCCGTGCACTT
CAAAACACTGTTCTTAAAACATGGCAAGGTCGTCCTGAGAATACTGAAGC
TGCCCAAAGTC
back to top