BQ623189

Overview
NameBQ623189
Unique NameBQ623189
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length622
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5279 contig Csv1_Contig5279:346..965. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623189 vs. ExPASy Swiss-Prot
Match: PTR2X_ARATH (Probable peptide transporter At1g52190 OS=Arabidopsis thaliana GN=At1g52190 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.212e-44
Identity = 90/147 (61.22%), Postives = 116/147 (78.91%), Query Frame = 2
Query:   95 LVPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVANLLASAIVSAVDHITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAYGPCVDRVTSVGDEGNDVKDEEEELLHLGNSRVGNEGNGLKKEE 535
            LVPQ+ L+GLAEA  AI QTEFFY+EFPKSMSSIAASLFGLGMAVA+LLAS +++AV+ +TS+ GKESWVS NINKG Y+ YYW+LAIMS +N++Y+++CSW+YGP VD+V +     N V+ EEEEL+ +        G G +KE+
Sbjct:  463 LVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVASLLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPLVDQVRN--GRVNGVR-EEEELIDI-------VGKGFEKED 599          
BLAST of BQ623189 vs. ExPASy Swiss-Prot
Match: PTR3B_ARATH (Peptide transporter PTR3-B OS=Arabidopsis thaliana GN=PTR3-B PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.143e-18
Identity = 44/99 (44.44%), Postives = 66/99 (66.67%), Query Frame = 2
Query:   95 LVPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVANLLASAIVSAVDHITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLV 391
            L+PQ+ L GLA+AF  IA+ EFFY + P+SM S+  S     MAV   ++S ++S+V  IT K G+  W+ +N+N+ R DNYY   A+++L+N + FLV
Sbjct:  459 LLPQYVLMGLADAFIEIAKLEFFYDQAPESMKSLGTSYTSTSMAVGYFMSSILLSSVSQITKKQGR-GWIQNNLNESRLDNYYMFFAVLNLLNFILFLV 556          
BLAST of BQ623189 vs. ExPASy Swiss-Prot
Match: PTR2_ARATH (Peptide transporter PTR2 OS=Arabidopsis thaliana GN=PTR2 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.650e-17
Identity = 43/97 (44.33%), Postives = 65/97 (67.01%), Query Frame = 2
Query:   98 VPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVANLLASAIVSAVDHITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNL-VYF 385
            +PQ+ + G AE F  I Q EFFY + P +M S+ ++L  L  A+ N L+S I++ V + T++ G+E W+S N+N G  D ++WLLA +SLVN+ VYF
Sbjct:  476 IPQYFILGAAEVFYFIGQLEFFYDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGQEGWISDNLNSGHLDYFFWLLAGLSLVNMAVYF 572          
BLAST of BQ623189 vs. ExPASy Swiss-Prot
Match: PTR3A_ARATH (Peptide transporter PTR3-A OS=Arabidopsis thaliana GN=PTR3-A PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.801e-17
Identity = 46/125 (36.80%), Postives = 74/125 (59.20%), Query Frame = 2
Query:   95 LVPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVANLLASAIVSAVDHITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAYGPCVDRVTSVGDEGNDVKDEE 469
            L+PQ  L G+A++F  +A+ EFFY + P+SM S+  S     +A+ N ++S ++S V  IT K G+  W+ +N+N+ R D YY   A+++LVN V FLV    Y    +   SV  +  ++K+ E
Sbjct:  459 LLPQFVLMGMADSFLEVAKLEFFYDQAPESMKSLGTSYSTTSLAIGNFMSSFLLSTVSEITKKRGR-GWILNNLNESRLDYYYLFFAVLNLVNFVLFLVVVKFYVYRAEVTDSVDVKEVEMKETE 582          
BLAST of BQ623189 vs. ExPASy Swiss-Prot
Match: PTR5_ARATH (Peptide transporter PTR5 OS=Arabidopsis thaliana GN=PTR5 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.270e-17
Identity = 41/102 (40.20%), Postives = 62/102 (60.78%), Query Frame = 2
Query:   98 VPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVANLLASAIVSAVDHITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVN-LVYFLVCSW 400
            VPQ+ L G AE F  I Q EFFY + P +M S+ ++L    +A  N L++ +V+ V  +T  GG+  W++ N+N G  D ++WLLA +S +N LVY  +  W
Sbjct:  458 VPQYFLVGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTAIAFGNYLSTFLVTLVTKVTRSGGRPGWIAKNLNNGHLDYFFWLLAGLSFLNFLVYLWIAKW 559          
BLAST of BQ623189 vs. ExPASy Swiss-Prot
Match: PTR1_ARATH (Peptide transporter PTR1 OS=Arabidopsis thaliana GN=PTR1 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.112e-16
Identity = 40/103 (38.83%), Postives = 63/103 (61.17%), Query Frame = 2
Query:   98 VPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVANLLASAIVSAVDHITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAY 406
            +PQ+ L G AE F  I Q EFFY + P +M S+ ++L    +A+ N L++ +V+ V  IT K GK  W+  N+N+G  D +++LLA +S +N + +L  S  Y
Sbjct:  458 IPQYLLIGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKITKKNGKPGWIPDNLNRGHLDYFFYLLATLSFLNFLVYLWISKRY 560          
BLAST of BQ623189 vs. ExPASy Swiss-Prot
Match: CHL1_ARATH (Nitrate/chlorate transporter OS=Arabidopsis thaliana GN=CHL1 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.107e-13
Identity = 41/120 (34.17%), Postives = 66/120 (55.00%), Query Frame = 2
Query:   95 LVPQHCLNGLAEAFNAIAQTEFFYSEFPKSMSSIAASLFGLGMAVANLLASAIVSAVDHITSKGGKESWVSSNINKGRYDNYYWLLAIMSLVNLVYFLVCSWAYGPCVDRVTSVGDEGND 454
            L+PQ+ + G+ EA     Q +FF  E PK M  ++  L    +A+    +S +V+ V+  T K     W++ ++NKGR  N+YWL+A++  +N + FLV S  Y     R+  VG E +D
Sbjct:  465 LIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGKA--HPWIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWYVYKEKRLAEVGIELDD 582          
The following BLAST results are available for this feature:
BLAST of BQ623189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
PTR2X_ARATH1.212e-4461.22Probable peptide transporter At1g52190 OS=Arabidop... [more]
PTR3B_ARATH1.143e-1844.44Peptide transporter PTR3-B OS=Arabidopsis thaliana... [more]
PTR2_ARATH1.650e-1744.33Peptide transporter PTR2 OS=Arabidopsis thaliana G... [more]
PTR3A_ARATH4.801e-1736.80Peptide transporter PTR3-A OS=Arabidopsis thaliana... [more]
PTR5_ARATH6.270e-1740.20Peptide transporter PTR5 OS=Arabidopsis thaliana G... [more]
PTR1_ARATH3.112e-1638.83Peptide transporter PTR1 OS=Arabidopsis thaliana G... [more]
CHL1_ARATH1.107e-1334.17Nitrate/chlorate transporter OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00280 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00280 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623189 ID=BQ623189|Name=BQ623189|organism=Citrus sinensis|type=EST|length=622bp
TCAGGACTTGTTGAGAATATTAGACGAAGAAGAGCTATCCGAGAAGGTTA
CCTGAACAATGGTCAAGCCGTGTTGGAAATGTCAGCAATGTGGCCTTGTG
CCACAGCATTGCTTGAACGGCTTAGCAGAAGCATTCAATGCAATCGCGCA
AACAGAGTTCTTTTACTCAGAGTTCCCAAAGAGTATGTCAAGTATAGCTG
CCTCCCTGTTTGGTCTAGGGATGGCTGTGGCAAACTTGTTAGCTAGTGCT
ATAGTAAGTGCCGTGGATCATATCACTTCAAAAGGAGGGAAAGAGAGCTG
GGTATCGAGCAATATCAACAAGGGTCGTTACGACAATTACTATTGGCTTC
TTGCTATAATGAGTCTTGTTAATTTGGTATACTTCCTCGTGTGTAGTTGG
GCATATGGACCTTGTGTTGACCGTGTAACGAGTGTTGGAGATGAAGGGAA
TGACGTAAAGGATGAAGAAGAAGAGCTACTTCATTTAGGCAATAGCCGAG
TTGGCAATGAAGGAAACGGCTTAAAGAAGGAAGAAAGTTTCTCATAGTCC
AGGGAATTGGGAGCATGATTTGAATTCACTCGGTTTGATATGATTTTGTT
TTACTGAATGTATGTATAATTA
back to top