BQ623204

Overview
NameBQ623204
Unique NameBQ623204
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length447
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623204 vs. ExPASy Swiss-Prot
Match: SDCG1_HUMAN (Serologically defined colon cancer antigen 1 OS=Homo sapiens GN=SDCCAG1 PE=1 SV=4)

HSP 1 Score: 66.6254 bits (161), Expect = 5.190e-11
Identity = 31/76 (40.79%), Postives = 45/76 (59.21%), Query Frame = 2
Query:    2 ILLYVIPVCGPYSAVQSYKYRVKIIPXXXXXXXXXXXXMNLFSHMPEATNREKELMKACTDPELVAAIIGNVKVAA 229
            +LL+ IP+C PY+ + +YKY+VK+ P            +N F H  EAT REK+L ++  D +L   I G VKV+A
Sbjct:  992 VLLFAIPICAPYTTMTNYKYKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIPGKVKVSA 1067          
The following BLAST results are available for this feature:
BLAST of BQ623204 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SDCG1_HUMAN5.190e-1140.79Serologically defined colon cancer antigen 1 OS=Ho... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00295 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00295 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623204 ID=BQ623204|Name=BQ623204|organism=Citrus sinensis|type=EST|length=447bp
CATCCTCTTATATGTCATCCCAGTTTGTGGCCCTTACAGTGCTGTACAAT
CTTACAAATACCGTGTGAAGATAATTCCTGGCACTGCAAAGAAAGGGAAA
GCCGCAAAGACTGCAATGAATTTATTTAGCCACATGCCTGAAGCAACAAA
TAGAGAGAAGGAATTAATGAAAGCATGCACAGATCCTGAACTGGTTGCTG
CTATTATCGGAAATGTGAAGGTCGCAGCTGCAGGTCTTACTCAATTGAAG
CAAAAGCAAAAGAAGGGCAAGAAGACCGGCAAACAACAAAGTTAGCCTGC
TTTGAAAGCCTTTTGGCTTTTACAAAATTTTATGTTGATAACATATCCTA
TTAGTGCAGAAAATTGATACCATGTTGTAAGAATCGTACAAATACAAATG
TATGAGGGTGTTTAATAATACGGTATGTTGTAAGAACCATACAAATA
back to top