BQ623206

Overview
NameBQ623206
Unique NameBQ623206
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length643
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5312 contig Csv1_Contig5312:127..769. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623206 vs. ExPASy Swiss-Prot
Match: AS1_ARATH (Transcription factor AS1 OS=Arabidopsis thaliana GN=AS1 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.816e-46
Identity = 100/162 (61.73%), Postives = 119/162 (73.46%), Query Frame = 2
Query:    2 STVAAA---PPIPWLQ---PERGSDNT--LVLGNMPPHGSVPICGENLLVSELMECCRELEEGHRAWAAHKKEAAWRLRRVELQLESEKACXXXXXXXXXXXXXXXLRDEQRATLDRIEAEYREQIAGLRRDAEAKEQKLAEQWSAKHLRLTKFLE-QMGCR 460
            STVAAA   PPIPWLQ   PER  +    LVLG+M P  S     E++ +SEL+ECCRELEEGHRAWA HKKEAAWRLRR+ELQLESEK C               LR+EQ+  +++IE EYREQ+ GLRRDAEAK+QKLA+QW+++H+RLTKFLE QMGCR
Sbjct:  204 STVAAAAPQPPIPWLQQQQPERAENGPGGLVLGSMMP--SCSGSSESVFLSELVECCRELEEGHRAWADHKKEAAWRLRRLELQLESEKTCRQREKMEEIEAKMKALREEQKNAMEKIEGEYREQLVGLRRDAEAKDQKLADQWTSRHIRLTKFLEQQMGCR 363          
BLAST of BQ623206 vs. ExPASy Swiss-Prot
Match: RS2_ORYSJ (Protein rough sheath 2 homolog OS=Oryza sativa subsp. japonica GN=RS2 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 5.297e-38
Identity = 74/118 (62.71%), Postives = 94/118 (79.66%), Query Frame = 2
Query:  110 GENLLVSELMECCRELEEGHRAWAAHKKEAAWRLRRVELQLESEKACXXXXXXXXXXXXXXXLRDEQRATLDRIEAEYREQIAGLRRDAEAKEQKLAEQWSAKHLRLTKFLEQM-GCR 460
            G  ++V+ELMECCRE+EEG RAWAAH+KEAAWR++RVE+QLE+E+AC               LR+EQ A ++R+EAEYRE++AGLRRDAEAKEQK+AEQW+AKH RL KFL+Q+  CR
Sbjct:  206 GGEVVVAELMECCREMEEGQRAWAAHRKEAAWRMKRVEMQLETERACRRREATEEFEAKMRALREEQAAAVERVEAEYREKMAGLRRDAEAKEQKMAEQWAAKHARLAKFLDQVAACR 323          
BLAST of BQ623206 vs. ExPASy Swiss-Prot
Match: RS2_MAIZE (Protein rough sheath 2 OS=Zea mays GN=RS2 PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.673e-32
Identity = 74/159 (46.54%), Postives = 99/159 (62.26%), Query Frame = 2
Query:    2 STVAAAPPIP--WLQPERGSDNTLVLGNMPP--HGSVPICG----ENLLVSELMECCRELEEGHRAWAAHKKEAAWRLRRVELQLESEKACXXXXXXXXXXXXXXXLRDEQRATLDRIEAEYREQIAGLRRDAEAKEQKLAEQWSAKHLRLTKFLEQMG 454
            + VA  PP P  W+ P+R + +    G   P  HG     G    +   ++EL ECCRELEEG RAWAAH++EAAWRL+RVE QLE E+                 +R EQ A  +R+E ++RE++A LRRDA+ KE+K+AEQW+AKH R+ KF+EQMG
Sbjct:  199 AAVAPGPPAPAPWM-PDRAAADAAPYGFPSPSQHGGAAPPGMAVVDGQALAELAECCRELEEGRRAWAAHRREAAWRLKRVEQQLEMEREMRRREVWEEFEAKMRTMRLEQAAAAERVERDHREKVAELRRDAQVKEEKMAEQWAAKHARVAKFVEQMG 356          
The following BLAST results are available for this feature:
BLAST of BQ623206 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
AS1_ARATH1.816e-4661.73Transcription factor AS1 OS=Arabidopsis thaliana G... [more]
RS2_ORYSJ5.297e-3862.71Protein rough sheath 2 homolog OS=Oryza sativa sub... [more]
RS2_MAIZE5.673e-3246.54Protein rough sheath 2 OS=Zea mays GN=RS2 PE=1 SV=... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00297 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00297 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623206 ID=BQ623206|Name=BQ623206|organism=Citrus sinensis|type=EST|length=643bp
CTCAACAGTTGCAGCAGCTCCTCCAATCCCATGGCTGCAGCCTGAGAGAG
GGTCAGATAACACCCTTGTTCTAGGAAATATGCCGCCACATGGCTCTGTC
CCTATATGTGGAGAGAACCTGCTGGTATCTGAGCTGATGGAGTGCTGTAG
AGAGTTGGAAGAAGGGCACCGTGCTTGGGCAGCACATAAGAAAGAAGCAG
CATGGAGATTGAGAAGGGTAGAGTTGCAGCTGGAATCAGAGAAAGCATGC
CGGAGGAGGGAGAAAATGGAGGAGATAGAGGCTAAGATGAAAGCTCTTAG
GGATGAGCAGAGGGCTACTTTGGATAGGATCGAAGCAGAATACAGGGAAC
AGATTGCTGGACTAAGAAGGGATGCTGAAGCCAAGGAGCAGAAACTGGCT
GAGCAATGGTCTGCAAAGCACTTGCGTCTTACCAAGTTTCTTGAGCAGAT
GGGGTGCAGGCCGAGGCTCTCTGAGTCCAATGGCCGTTGAGGACATCAGT
AATACACAATTGGCAATGCTGTACGTGGTCTGGCCTTTTGGTTTGAATTT
TGTGTCGTTAAAGTAATCTTCTATGTCTGAACAGGTTCCCACTGGCAGTA
TGCCTGGAATTCTGCTATAGATATTTATCTATAATTACTGTAA
back to top