BQ623236

Overview
NameBQ623236
Unique NameBQ623236
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length353
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:656..1008. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB21_ORYSJ (Chlorophyll a-b binding protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB1R PE=2 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 6.157e-37
Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  193 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265          
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB22_ORYSJ (Chlorophyll a-b binding protein 2, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB2R PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 1.372e-36
Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            +FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  189 SFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 261          
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB22_CUCSA (Chlorophyll a-b binding protein of LHCII type 1 (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 2.340e-36
Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            +FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  134 SFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 206          
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 2.340e-36
Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            +FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  183 SFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 255          
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 3.056e-36
Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            +FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct:  195 SFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267          
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.991e-36
Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            +FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:  195 SFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 267          
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.991e-36
Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            +FDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  195 SFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 267          
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.991e-36
Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            +FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:  194 SFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 266          
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB23_NICPL (Chlorophyll a-b binding protein C, chloroplastic OS=Nicotiana plumbaginifolia GN=CABC PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.991e-36
Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            +FDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  195 SFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 267          
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.991e-36
Identity = 71/73 (97.26%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   16 AFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 234
            +FDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  193 SFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265          
The following BLAST results are available for this feature:
BLAST of BQ623236 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
CB21_ORYSJ6.157e-37100.00Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB22_ORYSJ1.372e-3698.63Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB22_CUCSA2.340e-3697.26Chlorophyll a-b binding protein of LHCII type 1 (F... [more]
CB21_CUCSA2.340e-3697.26Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB25_PETSP3.056e-3697.26Chlorophyll a-b binding protein 91R, chloroplastic... [more]
CB2G_SOLLC3.991e-3697.26Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB24_TOBAC3.991e-3697.26Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB24_PETSP3.991e-3697.26Chlorophyll a-b binding protein 25, chloroplastic ... [more]
CB23_NICPL3.991e-3697.26Chlorophyll a-b binding protein C, chloroplastic O... [more]
CB22_TOBAC3.991e-3697.26Chlorophyll a-b binding protein 21, chloroplastic ... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00327 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00327 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623236 ID=BQ623236|Name=BQ623236|organism=Citrus sinensis|type=EST|length=353bp
TGTACCCAGGTGGCAGCGTTTGATCCATTGGGTTTGGCTGATGACCCGGA
GGCTTTTGCTGAGCTCAAGGTTAAGGAAATCAAGAATGGAAGGTTGGCTA
TGTTCTCCATGTTTGGTTTCTTCGTTCAGGCCATTGTCACCGGCAAGGGA
CCGTTAGAGAACTTGGCCGACCACTTGGCTGACCCTGTCAATAACAATGC
CTGGGCCTACGCCACCAACTTTGTCCCCGGAAAGTGAGCTTCGGTTGATA
AGAGTTTTTCTCTTTTCGGTTTCTTGGATATCATGTAAATCTGTTGTGAG
CTCATGGAAGCTTTAATTTGAGTTGTGATTATTTATAAAATGCTTCAATT
TGA
back to top