BQ623246

Overview
NameBQ623246
Unique NameBQ623246
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length572
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6152 contig Csv1_Contig6152:392..962. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_DANRE (Vacuolar protein sorting-associated protein 29 OS=Danio rerio GN=vps29 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 9.311e-46
Identity = 81/134 (60.45%), Postives = 110/134 (82.09%), Query Frame = 1
Query:    1 LKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT 402
            LK+L  D+H+ RG++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQLDVDIL++GHTH+F+A+++E    INPGSATGAYS+   ++ PSFVLMDI    VV YVY+LI  +VKV++I++KK+
Sbjct:   49 LKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQLDVDILISGHTHKFEAFENENKFYINPGSATGAYSALESNITPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 182          
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_PONAB (Vacuolar protein sorting-associated protein 29 OS=Pongo abelii GN=VPS29 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.074e-45
Identity = 80/134 (59.70%), Postives = 109/134 (81.34%), Query Frame = 1
Query:    1 LKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT 402
            LK+L  D+H+ RG++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQ DVDIL++GHTH+F+A++HE    INPGSATGAY++   ++ PSFVLMDI    VV YVY+LI  +VKV++I++KK+
Sbjct:   49 LKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALEANIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 182          
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_MOUSE (Vacuolar protein sorting-associated protein 29 OS=Mus musculus GN=Vps29 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.074e-45
Identity = 80/134 (59.70%), Postives = 109/134 (81.34%), Query Frame = 1
Query:    1 LKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT 402
            LK+L  D+H+ RG++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQ DVDIL++GHTH+F+A++HE    INPGSATGAY++   ++ PSFVLMDI    VV YVY+LI  +VKV++I++KK+
Sbjct:   49 LKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 182          
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_BOVIN (Vacuolar protein sorting-associated protein 29 OS=Bos taurus GN=VPS29 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.074e-45
Identity = 80/134 (59.70%), Postives = 109/134 (81.34%), Query Frame = 1
Query:    1 LKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT 402
            LK+L  D+H+ RG++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQ DVDIL++GHTH+F+A++HE    INPGSATGAY++   ++ PSFVLMDI    VV YVY+LI  +VKV++I++KK+
Sbjct:   53 LKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 186          
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_RAT (Vacuolar protein sorting-associated protein 29 OS=Rattus norvegicus GN=Vps29 PE=1 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 2.709e-45
Identity = 80/134 (59.70%), Postives = 108/134 (80.60%), Query Frame = 1
Query:    1 LKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT 402
            LK+L  D+H+ RG++DE   YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQ DVDIL++GHTH+F+A++HE    INPGSATGAY++   ++ PSFVLMDI    VV YVY+LI  +VKV++I++KK+
Sbjct:   49 LKTLAGDVHIVRGDFDESLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 182          
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_HUMAN (Vacuolar protein sorting-associated protein 29 OS=Homo sapiens GN=VPS29 PE=1 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 2.709e-45
Identity = 80/133 (60.15%), Postives = 108/133 (81.20%), Query Frame = 1
Query:    1 LKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKK 399
            LK+L  D+H+ RG++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQ DVDIL++GHTH+F+A++HE    INPGSATGAY++   ++ PSFVLMDI    VV YVY+LI  +VKV++I++KK
Sbjct:   49 LKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKK 181          
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_CHICK (Vacuolar protein sorting-associated protein 29 OS=Gallus gallus GN=VPS29 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 3.538e-45
Identity = 81/134 (60.45%), Postives = 108/134 (80.60%), Query Frame = 1
Query:    1 LKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT 402
            LK+L  D+HV RG++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQ DVDIL++GHTH+F+A++HE    INPGSATGAY +   ++ PSFVLMDI    VV YVY+LI  +VKV++I++KK+
Sbjct:   53 LKTLAGDVHVVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYHALENNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 186          
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_XENTR (Vacuolar protein sorting-associated protein 29 OS=Xenopus tropicalis GN=vps29 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 7.883e-45
Identity = 80/134 (59.70%), Postives = 109/134 (81.34%), Query Frame = 1
Query:    1 LKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT 402
            LK+L  D+H+ RG++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQLDVDIL++GHT +F+A++HE    INPGSATGAY++   ++ PSFVLMDI    VV YVY+LI  +VKV++I++KK+
Sbjct:   49 LKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQLDVDILISGHTQKFEAFEHENKFYINPGSATGAYNALENNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 182          
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_XENLA (Vacuolar protein sorting-associated protein 29 OS=Xenopus laevis GN=vps29 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 7.883e-45
Identity = 80/134 (59.70%), Postives = 109/134 (81.34%), Query Frame = 1
Query:    1 LKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT 402
            LK+L  D+H+ RG++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQLDVDIL++GHT +F+A++HE    INPGSATGAY++   ++ PSFVLMDI    VV YVY+LI  +VKV++I++KK+
Sbjct:   49 LKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQLDVDILISGHTQKFEAFEHENKFYINPGSATGAYNALENNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 182          
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Match: VPS29_DICDI (Vacuolar protein sorting-associated protein 29 OS=Dictyostelium discoideum GN=vps29 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.942e-43
Identity = 76/132 (57.58%), Postives = 104/132 (78.79%), Query Frame = 1
Query:    4 KSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKK 399
            K L  D+H+ RG+ DE++ YP+TK ++IGQFK G+CHGHQ++PWGD  SLA LQRQLDVD+L++GHTH  + ++  G + +NPGSATGA+S+ + DV PSFVLMD+    + VY+Y+LIDG+VKV+KID  K
Sbjct:   50 KVLTSDVHIVRGDLDENTSYPDTKIVSIGQFKFGLCHGHQIVPWGDRASLAALQRQLDVDVLISGHTHVLEVFESNGKLFVNPGSATGAFSNISNDVIPSFVLMDVQSNNITVYIYKLIDGQVKVEKIDHVK 181          
The following BLAST results are available for this feature:
BLAST of BQ623246 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
VPS29_DANRE9.311e-4660.45Vacuolar protein sorting-associated protein 29 OS=... [more]
VPS29_PONAB2.074e-4559.70Vacuolar protein sorting-associated protein 29 OS=... [more]
VPS29_MOUSE2.074e-4559.70Vacuolar protein sorting-associated protein 29 OS=... [more]
VPS29_BOVIN2.074e-4559.70Vacuolar protein sorting-associated protein 29 OS=... [more]
VPS29_RAT2.709e-4559.70Vacuolar protein sorting-associated protein 29 OS=... [more]
VPS29_HUMAN2.709e-4560.15Vacuolar protein sorting-associated protein 29 OS=... [more]
VPS29_CHICK3.538e-4560.45Vacuolar protein sorting-associated protein 29 OS=... [more]
VPS29_XENTR7.883e-4559.70Vacuolar protein sorting-associated protein 29 OS=... [more]
VPS29_XENLA7.883e-4559.70Vacuolar protein sorting-associated protein 29 OS=... [more]
VPS29_DICDI1.942e-4357.58Vacuolar protein sorting-associated protein 29 OS=... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00337 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00337 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623246 ID=BQ623246|Name=BQ623246|organism=Citrus sinensis|type=EST|length=572bp
TTGAAGAGTCTTTGTCCTGATTTGCATGTCACTCGAGGTGAATATGATGA
AGATTCACGTTATCCCGAAACTAAGACACTCACCATTGGGCAATTCAAGC
TTGGAATCTGCCATGGTCATCAGGTTATTCCATGGGGGGACTTGGATTCG
CTGGCAATGCTGCAAAGGCAGTTGGATGTGGACATCCTTGTGACTGGTCA
TACCCATCAGTTCAAAGCCTACAAACATGAAGGTGGTGTTGTTATAAATC
CTGGCTCTGCAACTGGTGCCTACAGTAGCTTTACATTTGATGTAAACCCA
AGCTTTGTACTCATGGACATTGATGGTCTGCGAGTTGTGGTTTATGTATA
CGAATTAATTGACGGTGAAGTAAAGGTTGACAAAATTGATTTTAAGAAGA
CTGCCACTACTCGATTAGCACACTGATTCAGCACACTGCATCCTTGACTT
TGTTGGACTAATTGCTGAGAACTTTTATGTAATGCCAATAAGTTGTTCAT
GTGTAAATTCTCTTTAACAGTTTTGCTGGATTCTGGAGATCATGTATTGA
AACGAATAAATCGAATATTTAC
back to top