BQ623249

Overview
NameBQ623249
Unique NameBQ623249
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length582
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623249 vs. ExPASy Swiss-Prot
Match: METL6_HUMAN (Methyltransferase-like protein 6 OS=Homo sapiens GN=METTL6 PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 2.644e-11
Identity = 39/67 (58.21%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  370 DLLNRFFVLSAVSPEKMSLVLQNIKKGLKPTGYVLFRDYAIGDLAQERLTGKDQKISENFYVRGDGT 570
            D++   FVLSAV P+KM LVLQNI K LKP   VLFRDY + D A  R      K+ ENFYVR DGT
Sbjct:  152 DVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKA-SSKLGENFYVRQDGT 217          
BLAST of BQ623249 vs. ExPASy Swiss-Prot
Match: METL6_PONAB (Methyltransferase-like protein 6 OS=Pongo abelii GN=METTL6 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.454e-11
Identity = 39/67 (58.21%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  370 DLLNRFFVLSAVSPEKMSLVLQNIKKGLKPTGYVLFRDYAIGDLAQERLTGKDQKISENFYVRGDGT 570
            D++   FVLSAV P+KM LVLQNI K LKP   VLFRDY + D A  R      K+ ENFYVR DGT
Sbjct:  152 DVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKA-GSKLGENFYVRQDGT 217          
BLAST of BQ623249 vs. ExPASy Swiss-Prot
Match: METL6_RAT (Methyltransferase-like protein 6 OS=Rattus norvegicus GN=Mettl6 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.891e-11
Identity = 38/67 (56.72%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  370 DLLNRFFVLSAVSPEKMSLVLQNIKKGLKPTGYVLFRDYAIGDLAQERLTGKDQKISENFYVRGDGT 570
            D +   FVLSAV PEKM LVL N+ K LKP   VLFRDY + D A  R      K+ ENFYVR DGT
Sbjct:  152 DAVTLIFVLSAVHPEKMHLVLLNVYKVLKPGRSVLFRDYGLNDHAMLRFKA-GSKLGENFYVRQDGT 217          
BLAST of BQ623249 vs. ExPASy Swiss-Prot
Match: METL6_MOUSE (Methyltransferase-like protein 6 OS=Mus musculus GN=Mettl6 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 5.891e-11
Identity = 38/67 (56.72%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  370 DLLNRFFVLSAVSPEKMSLVLQNIKKGLKPTGYVLFRDYAIGDLAQERLTGKDQKISENFYVRGDGT 570
            D +   FVLSAV PEKM LVL N+ K LKP   VLFRDY + D A  R      K+ ENFYVR DGT
Sbjct:  152 DAVTLIFVLSAVHPEKMRLVLLNVYKVLKPGRSVLFRDYGLNDHAMLRFKA-GSKLGENFYVRQDGT 217          
BLAST of BQ623249 vs. ExPASy Swiss-Prot
Match: METL2_CHICK (Methyltransferase-like protein 2 OS=Gallus gallus GN=METTL2 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.694e-11
Identity = 36/67 (53.73%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  370 DLLNRFFVLSAVSPEKMSLVLQNIKKGLKPTGYVLFRDYAIGDLAQERLTGKDQKISENFYVRGDGT 570
            D++   FVLSA+ PEKM  V+  + + LKP G +L RDY   DLAQ R   K Q +S NFYVRGDGT
Sbjct:  248 DIVILIFVLSAILPEKMQCVINKLSRLLKPGGMILLRDYGRYDLAQLRFK-KGQCLSANFYVRGDGT 313          
The following BLAST results are available for this feature:
BLAST of BQ623249 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
METL6_HUMAN2.644e-1158.21Methyltransferase-like protein 6 OS=Homo sapiens G... [more]
METL6_PONAB3.454e-1158.21Methyltransferase-like protein 6 OS=Pongo abelii G... [more]
METL6_RAT5.891e-1156.72Methyltransferase-like protein 6 OS=Rattus norvegi... [more]
METL6_MOUSE5.891e-1156.72Methyltransferase-like protein 6 OS=Mus musculus G... [more]
METL2_CHICK7.694e-1153.73Methyltransferase-like protein 2 OS=Gallus gallus ... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00340 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00340 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623249 ID=BQ623249|Name=BQ623249|organism=Citrus sinensis|type=EST|length=582bp
GCTGCATACCCAGATGTTTTTGTCCATGCTTGCGATTTTTCACCTCGTGC
CGTTAACTTGGTCATGACCCATAAAGACTTCACAGAGACTCATGTCAGCA
CATTCGTTTGTGACCTAACCAGTGATGACCTAAGCAGACAGATTTCTCCA
TCTTCAATTGATATAGTGACCATGGTATTTGACTGGAAGTTATGTTTTAT
AAAACTGTGACATGATTATTCAATAACTGTTTGGTCAAATTCCCTAATGG
TTATAATTGGTGTTCTATCTAGTTTCTAATCGAGAAAAAGTTGCTCTTGT
ACTCAAGCCTTCACTTGTGATGTCTTTGTTTTGCCTATCAATAAATAGCA
GTTTGTTTCCTAGCCAGCTGACCTGTTAAATAGGTTTTTTGTGTTATCTG
CAGTGTCACCTGAAAAGATGTCTTTAGTCTTACAAAACATTAAAAAGGGT
CTCAAGCCAACTGGGTATGTGCTGTTTCGTGACTATGCTATTGGTGACCT
TGCTCAGGAAAGGCTAACAGGCAAGGACCAAAAAATCAGTGAAAACTTTT
ATGTCAGGGGTGATGGCACTGTTGAAAACCGG
back to top