BQ623352

Overview
NameBQ623352
Unique NameBQ623352
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length692
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig764 contig Csv1_Contig764:731..1424. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3C_RICCO (Omega-3 fatty acid desaturase, chloroplastic OS=Ricinus communis GN=FAD7A-1 PE=2 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 1.362e-116
Identity = 172/198 (86.87%), Postives = 186/198 (93.94%), Query Frame = 2
Query:    5 KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKI+++LD+ T+ LRF +PFP+LAYPFYLWSRSPGK GSHF P+S LFVP ERKD+ITST CWTAMAALLV L+F MGP+Q+LKLYG+PYWIFVMWLD VTYLHHHGHEDKLPWYRGK WSYLRGGLTTLDRDYGW+NNIHHDIGTHVIHHLF
Sbjct:  189 KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIFKSLDNVTKTLRFSLPFPMLAYPFYLWSRSPGKKGSHFHPDSGLFVPKERKDIITSTACWTAMAALLVYLNFSMGPVQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKAWSYLRGGLTTLDRDYGWINNIHHDIGTHVIHHLF 386          

HSP 2 Score: 47.3654 bits (111), Expect = 1.362e-116
Identity = 20/31 (64.52%), Postives = 23/31 (74.19%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLGNITVSQRNRGP 690
            PQIPHYHL+EATEAAKPV+G      +  GP
Sbjct:  387 PQIPHYHLVEATEAAKPVMGKYYREPKKSGP 417          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3C_SESIN (Omega-3 fatty acid desaturase, chloroplastic OS=Sesamum indicum GN=FAD7 PE=2 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 3.027e-116
Identity = 176/198 (88.89%), Postives = 188/198 (94.95%), Query Frame = 2
Query:    5 KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            KLNSVVGH+LHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIY+ LD+AT+ LRF +PFPLLAYP YLWSRSPGK GSHF P+SDLFVP+E+KDVITSTVCWTAM ALLVGLSFV+GP+QLLKLYG+PY   VMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGW+NNIHHDIGTHVIHHLF
Sbjct:  179 KLNSVVGHILHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYKNLDTATKKLRFTLPFPLLAYPIYLWSRSPGKQGSHFHPDSDLFVPNEKKDVITSTVCWTAMLALLVGLSFVIGPVQLLKLYGIPYLGNVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWINNIHHDIGTHVIHHLF 376          

HSP 2 Score: 46.2098 bits (108), Expect = 3.027e-116
Identity = 21/31 (67.74%), Postives = 22/31 (70.97%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLGNITVSQRNRGP 690
            PQIPHYHLIEATEAAKPVLG      +   P
Sbjct:  377 PQIPHYHLIEATEAAKPVLGKYYREPKKSAP 407          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3D_ARATH (Temperature-sensitive omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD8 PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 1.494e-115
Identity = 166/198 (83.84%), Postives = 183/198 (92.42%), Query Frame = 2
Query:    5 KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            +LNSV GHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPL E IY+ L+  T+  RF +PFP+LAYPFYLW+RSPGK GSH+ P+SDLF+P E+KDV+TST CWTAMAALLV L+FVMGP+Q+LKLYG+PYWIFVMWLD VTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGW+NNIHHDIGTHVIHHLF
Sbjct:  168 RLNSVAGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLPESIYKNLEKTTQMFRFTLPFPMLAYPFYLWNRSPGKQGSHYHPDSDLFLPKEKKDVLTSTACWTAMAALLVCLNFVMGPIQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWINNIHHDIGTHVIHHLF 365          

HSP 2 Score: 50.447 bits (119), Expect = 1.494e-115
Identity = 22/31 (70.97%), Postives = 24/31 (77.42%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLGNITVSQRNRGP 690
            PQIPHYHL+EATEAAKPVLG      +N GP
Sbjct:  366 PQIPHYHLVEATEAAKPVLGKYYREPKNSGP 396          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3C_SOYBN (Omega-3 fatty acid desaturase, chloroplastic OS=Glycine max GN=FAD7 PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 3.331e-114
Identity = 172/198 (86.87%), Postives = 185/198 (93.43%), Query Frame = 2
Query:    5 KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            KLNSVVGHLLHSSILVPYHGWRISHRTHHQ+HGH ENDESWHPL EK++R+LD+ TR LRF  PFPLLA+P YL+SRSPGK+GSHFDP+SDLFVP+ERKDVITST CW AM  LLVGL FVMGP+QLLKLYG+PY IFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGW+NNIHHDIGTHVIHHLF
Sbjct:  183 KLNSVVGHLLHSSILVPYHGWRISHRTHHQHHGHAENDESWHPLPEKLFRSLDTVTRMLRFTAPFPLLAFPVYLFSRSPGKTGSHFDPSSDLFVPNERKDVITSTACWAAMLGLLVGLGFVMGPIQLLKLYGVPYVIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWINNIHHDIGTHVIHHLF 380          

HSP 2 Score: 43.8986 bits (102), Expect = 3.331e-114
Identity = 18/20 (90.00%), Postives = 19/20 (95.00%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLG 657
            PQIPHYHL+EATEAAKPV G
Sbjct:  381 PQIPHYHLVEATEAAKPVFG 400          

HSP 3 Score: 23.8682 bits (50), Expect = 3.331e-114
Identity = 9/9 (100.00%), Postives = 9/9 (100.00%), Query Frame = 3
Query:  657 KYYREPKKS 683
            KYYREPKKS
Sbjct:  401 KYYREPKKS 409          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3C_ARATH (Omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD7 PE=1 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 3.988e-113
Identity = 168/198 (84.85%), Postives = 182/198 (91.92%), Query Frame = 2
Query:    5 KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHP+SEKIY TLD  TRF RF +P  +LAYPFYLW+RSPGK GSH+ P+SDLF+P ERKDV+TST CWTAMAALLV L+F +GP+Q+LKLYG+PYWI VMWLD VTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYG +NNIHHDIGTHVIHHLF
Sbjct:  175 KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPMSEKIYNTLDKPTRFFRFTLPLVMLAYPFYLWARSPGKKGSHYHPDSDLFLPKERKDVLTSTACWTAMAALLVCLNFTIGPIQMLKLYGIPYWINVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGLINNIHHDIGTHVIHHLF 372          

HSP 2 Score: 46.595 bits (109), Expect = 3.988e-113
Identity = 21/31 (67.74%), Postives = 22/31 (70.97%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLGNITVSQRNRGP 690
            PQIPHYHL+EATEAAKPVLG         GP
Sbjct:  373 PQIPHYHLVEATEAAKPVLGKYYREPDKSGP 403          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3C_BRANA (Omega-3 fatty acid desaturase, chloroplastic (Fragment) OS=Brassica napus GN=FAD7 PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 7.446e-112
Identity = 166/198 (83.84%), Postives = 181/198 (91.41%), Query Frame = 2
Query:    5 KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            +LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHP+SEKIY++LD  TRF RF +P  +LAYPFYLW+RSPGK GSH+ P+SDLF+P ER DV+TST CWTAMA LLV L+FVMGPMQ+LKLY +PYWI VMWLD VTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYG +NNIHHDIGTHVIHHLF
Sbjct:  133 RLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPMSEKIYKSLDKPTRFFRFTLPLVMLAYPFYLWARSPGKKGSHYHPDSDLFLPKERNDVLTSTACWTAMAVLLVCLNFVMGPMQMLKLYVIPYWINVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGLINNIHHDIGTHVIHHLF 330          

HSP 2 Score: 46.595 bits (109), Expect = 7.446e-112
Identity = 21/31 (67.74%), Postives = 22/31 (70.97%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLGNITVSQRNRGP 690
            PQIPHYHL+EATEAAKPVLG         GP
Sbjct:  331 PQIPHYHLVEATEAAKPVLGKYYREPDKSGP 361          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3E_SOYBN (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Glycine max GN=FAD3 PE=2 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 3.438e-103
Identity = 151/197 (76.65%), Postives = 171/197 (86.80%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            LNS+VGH+LHSSILVPYHGWRISHRTHHQNHGH+E DESW PL+EKIY+ LDS TR +RF +PFPL  YP YL+SRSPGK GSHF+P S+LF PSERK +  ST+CW  M +LL+ LSF+  P+ +LKLYG+PYWIFVMWLD VTYLHHHGH  KLPWYRGKEWSYLRGGLTT+DRDYGW+ NIHHDIGTHVIHHLF
Sbjct:  113 LNSLVGHILHSSILVPYHGWRISHRTHHQNHGHIEKDESWVPLTEKIYKNLDSMTRLIRFTVPFPLFVYPIYLFSRSPGKEGSHFNPYSNLFPPSERKGIAISTLCWATMFSLLIYLSFITSPLLVLKLYGIPYWIFVMWLDFVTYLHHHGHHQKLPWYRGKEWSYLRGGLTTVDRDYGWIYNIHHDIGTHVIHHLF 309          

HSP 2 Score: 44.669 bits (104), Expect = 3.438e-103
Identity = 18/21 (85.71%), Postives = 21/21 (100.00%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLGN 660
            PQIPHYHL+EAT+AAKPVLG+
Sbjct:  310 PQIPHYHLVEATQAAKPVLGD 330          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3E_PHAAU (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Phaseolus aureus GN=ARG1 PE=2 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 2.905e-99
Identity = 146/198 (73.74%), Postives = 171/198 (86.36%), Query Frame = 2
Query:    5 KLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            KLNS VGH+LHS ILVPY+GWRISHRTHHQNHGHVE DESW PL+EK+Y+ LD  TR LR+  PFP+ AYPFYLW+RSPGK GSHF+P S+LF P ERK V+TST+CW  + ++L+ LS  +GP+ +LKLYG+PY IFVMWLD VTYLHHHG+  KLPWYRG+EWSYLRGGLTT+DRDYGW+NN+HHDIGTHVIHHLF
Sbjct:  109 KLNSFVGHILHSLILVPYNGWRISHRTHHQNHGHVEKDESWVPLTEKVYKNLDDMTRMLRYSFPFPIFAYPFYLWNRSPGKEGSHFNPYSNLFSPGERKGVVTSTLCWGIVLSVLLYLSLTIGPIFMLKLYGVPYLIFVMWLDFVTYLHHHGYTHKLPWYRGQEWSYLRGGLTTVDRDYGWINNVHHDIGTHVIHHLF 306          

HSP 2 Score: 41.9726 bits (97), Expect = 2.905e-99
Identity = 18/31 (58.06%), Postives = 22/31 (70.97%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLGNITVSQRNRGP 690
            PQIPHYHL+EAT++AK VLG      +  GP
Sbjct:  307 PQIPHYHLVEATKSAKSVLGKYYREPQKSGP 337          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3E_BRANA (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Brassica napus GN=FAD3 PE=2 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 1.958e-98
Identity = 150/197 (76.14%), Postives = 169/197 (85.79%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            LNSVVGH+LHS ILVPYHGWRISHRTHHQNHGHVENDESW PL EK+Y+ L  +TR LR+ +P P+LAYP YLW RSPGK GSHF+P S LF PSERK + TST CW+ M A LV LSF++ P+ +LK+YG+PY IFVMWLD VTYLHHHGH++KLPWYRGKEWSYLRGGLTT+DRDYG  NNIHHDIGTHVIHHLF
Sbjct:  111 LNSVVGHILHSFILVPYHGWRISHRTHHQNHGHVENDESWVPLPEKLYKNLPHSTRMLRYTVPLPMLAYPIYLWYRSPGKEGSHFNPYSSLFAPSERKLIATSTTCWSIMLATLVYLSFLVDPVTVLKVYGVPYIIFVMWLDAVTYLHHHGHDEKLPWYRGKEWSYLRGGLTTIDRDYGIFNNIHHDIGTHVIHHLF 307          

HSP 2 Score: 38.891 bits (89), Expect = 1.958e-98
Identity = 16/20 (80.00%), Postives = 18/20 (90.00%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLG 657
            PQIPHYHL++AT AAK VLG
Sbjct:  308 PQIPHYHLVDATRAAKHVLG 327          

HSP 3 Score: 22.7126 bits (47), Expect = 1.958e-98
Identity = 8/10 (80.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:  657 KYYREPKKSG 686
            +YYREPK SG
Sbjct:  328 RYYREPKTSG 337          
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Match: FAD3E_TOBAC (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Nicotiana tabacum GN=FAD3 PE=2 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 2.439e-98
Identity = 149/197 (75.63%), Postives = 169/197 (85.79%), Query Frame = 2
Query:    8 LNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKSGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWVNNIHHDIGTHVIHHLF 598
            LN+VVGH+LHS+ILVPYHGWRISH+THHQNHG+VE DESW P+ EK+Y  +  +T+FLR+KIPFPLLAYP YL  RSPGKSGSHF+P SDLF P ERK V+TST+CWT MAALL+ L    G +Q+ K+YG PY IFVMWLD VTYLHHHG+E KLPWYRGKEWSYLRGGLTT+DRDYG  NNIHHDIGTHVIHHLF
Sbjct:  110 LNNVVGHILHSAILVPYHGWRISHKTHHQNHGNVETDESWVPMPEKLYNKVGYSTKFLRYKIPFPLLAYPMYLMKRSPGKSGSHFNPYSDLFQPHERKYVVTSTLCWTVMAALLLYLCTAFGSLQMFKIYGAPYLIFVMWLDFVTYLHHHGYEKKLPWYRGKEWSYLRGGLTTVDRDYGLFNNIHHDIGTHVIHHLF 306          

HSP 2 Score: 44.2838 bits (103), Expect = 2.439e-98
Identity = 20/31 (64.52%), Postives = 22/31 (70.97%), Query Frame = 1
Query:  598 PQIPHYHLIEATEAAKPVLGNITVSQRNRGP 690
            PQIPHYHL EAT+AAKPVLG      +  GP
Sbjct:  307 PQIPHYHLREATKAAKPVLGKYYREPKKSGP 337          
The following BLAST results are available for this feature:
BLAST of BQ623352 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
FAD3C_RICCO1.362e-11686.87Omega-3 fatty acid desaturase, chloroplastic OS=Ri... [more]
FAD3C_SESIN3.027e-11688.89Omega-3 fatty acid desaturase, chloroplastic OS=Se... [more]
FAD3D_ARATH1.494e-11583.84Temperature-sensitive omega-3 fatty acid desaturas... [more]
FAD3C_SOYBN3.331e-11486.87Omega-3 fatty acid desaturase, chloroplastic OS=Gl... [more]
FAD3C_ARATH3.988e-11384.85Omega-3 fatty acid desaturase, chloroplastic OS=Ar... [more]
FAD3C_BRANA7.446e-11283.84Omega-3 fatty acid desaturase, chloroplastic (Frag... [more]
FAD3E_SOYBN3.438e-10376.65Omega-3 fatty acid desaturase, endoplasmic reticul... [more]
FAD3E_PHAAU2.905e-9973.74Omega-3 fatty acid desaturase, endoplasmic reticul... [more]
FAD3E_BRANA1.958e-9876.14Omega-3 fatty acid desaturase, endoplasmic reticul... [more]
FAD3E_TOBAC2.439e-9875.63Omega-3 fatty acid desaturase, endoplasmic reticul... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00443 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00443 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623352 ID=BQ623352|Name=BQ623352|organism=Citrus sinensis|type=EST|length=692bp
TCACAAGTTGAATAGTGTGGTGGGGCATCTGCTGCATTCTTCAATTCTGG
TTCCTTATCATGGATGGAGAATTAGCCACAGGACTCATCATCAAAACCAT
GGGCATGTTGAGAATGATGAATCCTGGCACCCGTTGTCTGAGAAAATTTA
CAGGACTTTGGATAGTGCAACAAGATTTTTGAGATTCAAAATTCCTTTTC
CCTTGCTTGCATATCCCTTTTATCTTTGGAGTAGGAGTCCGGGGAAGTCT
GGTTCTCACTTTGACCCTAACAGTGACCTGTTTGTCCCAAGTGAGAGGAA
GGATGTGATCACTTCAACAGTATGCTGGACGGCCATGGCTGCTTTGCTAG
TGGGTTTATCATTTGTAATGGGTCCTATGCAGTTGCTTAAACTCTATGGC
CTTCCATATTGGATTTTTGTCATGTGGCTGGACCTTGTGACTTACTTGCA
TCACCATGGGCATGAAGACAAACTTCCGTGGTATCGTGGAAAGGAATGGA
GTTACTTAAGGGGAGGGCTCACAACACTTGATCGTGACTATGGATGGGTC
AATAACATCCACCACGATATTGGAACCCACGTCATACATCACCTCTTCCT
CAGATCCCGCATTACCACTTAATAGAAGCAACTGAGGCTGCTAAACCAGT
TCTTGGAAATATTACCGTGAGCCAAAGAAATCGGGGACCGAT
back to top