BQ623357

Overview
NameBQ623357
Unique NameBQ623357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length439
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5152 contig Csv1_Contig5152:65..503. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623357 vs. ExPASy Swiss-Prot
Match: NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 5.630e-23
Identity = 42/70 (60.00%), Postives = 55/70 (78.57%), Query Frame = 1
Query:   76 EAATCNPTELSPCLAALTSSAPPSGPCCNKLRQQRPCLCGYLRDPNLKQYVNSPNAKRVVATCGIPYPRC 285
            EA TCNPTELS C+ A+T  + PS  CC+KL+ Q PCLC Y+++P+LKQYVNSP AK+V++ CG+ YP C
Sbjct:   30 EAVTCNPTELSSCVPAITGGSKPSSTCCSKLKVQEPCLCNYIKNPSLKQYVNSPGAKKVLSNCGVTYPNC 99          
BLAST of BQ623357 vs. ExPASy Swiss-Prot
Match: NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.638e-22
Identity = 40/67 (59.70%), Postives = 54/67 (80.60%), Query Frame = 1
Query:   85 TCNPTELSPCLAALTSSAPPSGPCCNKLRQQRPCLCGYLRDPNLKQYVNSPNAKRVVATCGIPYPRC 285
            TC+P +LSPCL  + S AP    CC KLR+QRPCLCGYL++P+L+QYVNSPNA+++ + CG+P P+C
Sbjct:    2 TCSPVQLSPCLGPINSGAPSPTTCCQKLREQRPCLCGYLKNPSLRQYVNSPNARKLASNCGVPVPQC 68          
BLAST of BQ623357 vs. ExPASy Swiss-Prot
Match: NLTP2_HORVU (Probable non-specific lipid-transfer protein OS=Hordeum vulgare GN=LTP2 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.308e-15
Identity = 32/68 (47.06%), Postives = 43/68 (63.24%), Query Frame = 1
Query:   82 ATCNPTELSPCLAALTSSAPPSGPCCNKLRQQRPCLCGYLRDPNLKQYVNSPNAKRVVATCGIPYPRC 285
            A C P +L+ C +A+     PSG CC  LR Q+ CLC Y++DPN   YV+SP+A+  +  CGIP P C
Sbjct:   35 AACEPAQLAVCASAILGGTKPSGECCGNLRAQQGCLCQYVKDPNYGHYVSSPHARDTLNLCGIPVPHC 102          
BLAST of BQ623357 vs. ExPASy Swiss-Prot
Match: NLTP2_MAIZE (Probable non-specific lipid-transfer protein 2 OS=Zea mays PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.144e-14
Identity = 35/71 (49.30%), Postives = 44/71 (61.97%), Query Frame = 1
Query:   79 AATCNPTELSPCL--AALTSSAPPSGPCCNKLRQQRPCLCGYLRDPNLKQYVNSPNAKRVVATCGIPYPRC 285
            A  CNP +L+PC   A    + PP+  CC +LR Q+ CLCGY R PN   Y+ SPNA R+ A C +P PRC
Sbjct:    1 ANPCNPAQLTPCAGPALFGGAVPPA--CCAQLRAQQGCLCGYARSPNYGSYIRSPNAARLFAICNLPMPRC 69          
BLAST of BQ623357 vs. ExPASy Swiss-Prot
Match: NLTPX_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica GN=LTP-2 PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 4.777e-14
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 1
Query:   82 ATCNPTELSPCLAALTSSAPPSGPCCNKLRQQRPCLCGYLRDPNLKQYVNSPNAKRVVATCGIPYPRC 285
            A+CN  +L+ C  A+   A P+  CC+ LR Q+ C C + +DP   +YVNSPNA++ V++CGI  P C
Sbjct:   28 ASCNAGQLTVCAGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTC 95          
BLAST of BQ623357 vs. ExPASy Swiss-Prot
Match: NLT2P_WHEAT (Non-specific lipid-transfer protein 2P OS=Triticum aestivum PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.777e-14
Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 1
Query:   88 CNPTELSPCLAALTSSAPPSGPCCNKLRQQRPCLCGYLRDPNLKQYVNSPNAKRVVATCGIPYPRC 285
            C  ++L+ C +A+ S A PSG CC  LR Q+PC C Y +DP   QY+ SP+A+  + +CG+  P C
Sbjct:    2 CQASQLAVCASAILSGAKPSGECCGNLRAQQPCFCQYAKDPTYGQYIRSPHARDTLQSCGLAVPHC 67          
BLAST of BQ623357 vs. ExPASy Swiss-Prot
Match: NLTPX_ORYSJ (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. japonica GN=LTP-2 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.064e-13
Identity = 30/68 (44.12%), Postives = 43/68 (63.24%), Query Frame = 1
Query:   82 ATCNPTELSPCLAALTSSAPPSGPCCNKLRQQRPCLCGYLRDPNLKQYVNSPNAKRVVATCGIPYPRC 285
            A CN  +L+ C  A+   A P+  CC+ LR Q+ C C + +DP   +YVNSPNA++ V++CGI  P C
Sbjct:   28 AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTC 95          
BLAST of BQ623357 vs. ExPASy Swiss-Prot
Match: NLT2G_WHEAT (Non-specific lipid-transfer protein 2G OS=Triticum aestivum PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 4.044e-13
Identity = 28/66 (42.42%), Postives = 41/66 (62.12%), Query Frame = 1
Query:   88 CNPTELSPCLAALTSSAPPSGPCCNKLRQQRPCLCGYLRDPNLKQYVNSPNAKRVVATCGIPYPRC 285
            C  ++L+ C +A+ S A PSG CC  LR Q+ C C Y +DP   QY+ SP+A+  + +CG+  P C
Sbjct:    2 CQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC 67          
The following BLAST results are available for this feature:
BLAST of BQ623357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
NLTP_VIGUN5.630e-2360.00Probable non-specific lipid-transfer protein AKCS9... [more]
NLTP2_PRUAR1.638e-2259.70Non-specific lipid-transfer protein 2 OS=Prunus ar... [more]
NLTP2_HORVU3.308e-1547.06Probable non-specific lipid-transfer protein OS=Ho... [more]
NLTP2_MAIZE2.144e-1449.30Probable non-specific lipid-transfer protein 2 OS=... [more]
NLTPX_ORYSI4.777e-1444.12Non-specific lipid-transfer protein 2 OS=Oryza sat... [more]
NLT2P_WHEAT4.777e-1443.94Non-specific lipid-transfer protein 2P OS=Triticum... [more]
NLTPX_ORYSJ1.064e-1344.12Non-specific lipid-transfer protein 2 OS=Oryza sat... [more]
NLT2G_WHEAT4.044e-1342.42Non-specific lipid-transfer protein 2G OS=Triticum... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00448 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00448 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623357 ID=BQ623357|Name=BQ623357|organism=Citrus sinensis|type=EST|length=439bp
TCTTCGGTTGAAGCTGTGAGGTTTGTGATGGTGGTTTTGGTGGCCGTGGC
AGCACTAAGCCAAGTGCATGTAGCAGAGGCAGCGACATGCAATCCAACAG
AGCTGAGCCCATGCTTGGCAGCTCTCACGTCGTCGGCGCCGCCGTCCGGA
CCATGCTGCAACAAGCTGAGGCAGCAGAGGCCATGCCTTTGTGGGTACCT
GAGAGACCCTAATCTGAAGCAATATGTTAACTCTCCCAATGCCAAAAGGG
TTGTTGCAACCTGTGGAATTCCCTATCCTCGGTGTTAGGTTTTAATTAAA
TGTTTTATCAAAAAGCTTGTCATAAATAAAAAAAGTGTGTTGCAAGATTG
ATTAGTGAGTATTAACATGGAATATGCTAAAGTTTGTGAATCATGGATGG
CTTGGTTGCCATCAATGTACTTATGAAGATGGAATATAT
back to top