BQ623551

Overview
NameBQ623551
Unique NameBQ623551
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623551_ssr267 microsatellite BQ623551_ssr267:267..278. BLAST: Citrus ESTs to Prunus persica proteins V1
BQ623551_ssr286 microsatellite BQ623551_ssr286:286..297. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1628 contig Csv1_Contig1628:82..686. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1B2_ARATH (Elongation factor 1-beta 2 OS=Arabidopsis thaliana GN=At5g19510 PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.407e-50
Identity = 103/191 (53.93%), Postives = 123/191 (64.40%), Query Frame = 2
Query:    2 TFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSSHIAPSFPGKAVGVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDLV 574
            TFSDLHTE G+KS++++L+GK+YISG+QL+ DD+KVYAAV VKP+D+FPNAS+WY+SV+S +A SFPGKAVGV+                                                            VL+DVKPWDDETDMKKLEEAVR VEMPGLFWGASKLVPVGYGIKK+ IM TI+DDLV
Sbjct:    4 TFSDLHTEEGVKSVEEHLAGKTYISGDQLSVDDVKVYAAVPVKPSDAFPNASKWYESVASQLAKSFPGKAVGVQFGGSAAAAPAVEAEAPAAAADDDDDMDLFGDETEEEKKAAEEREAAKKDTKKPKESGKSSVLMDVKPWDDETDMKKLEEAVRGVEMPGLFWGASKLVPVGYGIKKLTIMFTIVDDLV 194          
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1B_ORYSJ (Elongation factor 1-beta OS=Oryza sativa subsp. japonica GN=Os07g0662500 PE=1 SV=3)

HSP 1 Score: 187.193 bits (474), Expect = 5.531e-47
Identity = 99/191 (51.83%), Postives = 117/191 (61.26%), Query Frame = 2
Query:    2 TFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSSHIAPSFPGKAVGVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDLV 574
            TF+DLHT  GLK+L+Q+LSGK+Y+SGN ++KDDIKV+AAV  KP   FPNA+RWYD+V++ +A  FPGKAVGV                                                             VLLDVKPWDDETDMKKLEEAVRSV+M GL WGASKLVPVGYGIKK+QIM+TI+DDLV
Sbjct:    4 TFTDLHTADGLKALEQHLSGKTYVSGNAISKDDIKVFAAVPSKPGAEFPNAARWYDTVAAALASRFPGKAVGVNLPGGGAASSAAAAAPAAKDADEDDDDLDLFGDETEEDKKAADERAASKASSKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLTWGASKLVPVGYGIKKLQIMLTIVDDLV 194          
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1B1_ARATH (Elongation factor 1-beta 1 OS=Arabidopsis thaliana GN=At5g12110 PE=2 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 2.416e-26
Identity = 54/74 (72.97%), Postives = 66/74 (89.19%), Query Frame = 2
Query:    2 TFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSSHIAPSFPGKAVGVR 223
            TFSDLHTE GLK+L+++L+GK+YISG+QL+ DD+KVYAAVL  P D FPNAS+WYDSV+SH+A SFPGKA GVR
Sbjct:    4 TFSDLHTERGLKTLEEHLAGKTYISGDQLSVDDVKVYAAVLENPGDGFPNASKWYDSVASHLAKSFPGKADGVR 77          

HSP 2 Score: 108.612 bits (270), Expect = 2.500e-23
Identity = 51/57 (89.47%), Postives = 55/57 (96.49%), Query Frame = 2
Query:  404 VLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDLV 574
            VLL+VKPWDDETDMKKLEEAVRSV+MPGL WGASKLVPVGYGIKK+ IMMTI+DDLV
Sbjct:  142 VLLEVKPWDDETDMKKLEEAVRSVQMPGLTWGASKLVPVGYGIKKLTIMMTIVDDLV 198          
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1D2_ARATH (Elongation factor 1-delta 2 OS=Arabidopsis thaliana GN=At2g18110 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 9.501e-23
Identity = 48/57 (84.21%), Postives = 54/57 (94.74%), Query Frame = 2
Query:  404 VLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDLV 574
            VL+D+KPWDDETDMKKLEEAVRS++M GLFWGASKLVPVGYGIKK+ IM TI+DDLV
Sbjct:  145 VLMDIKPWDDETDMKKLEEAVRSIQMEGLFWGASKLVPVGYGIKKLHIMCTIVDDLV 201          
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1D2_ORYSJ (Elongation factor 1-delta 2 OS=Oryza sativa subsp. japonica GN=Os03g0406200 PE=2 SV=3)

HSP 1 Score: 106.301 bits (264), Expect = 1.241e-22
Identity = 50/57 (87.72%), Postives = 54/57 (94.74%), Query Frame = 2
Query:  404 VLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDLV 574
            VLLDVKPWDDETDM KLEEAVR+V+M GL WGASKLVPVGYGIKK+QIMMTI+DDLV
Sbjct:  140 VLLDVKPWDDETDMAKLEEAVRNVKMEGLLWGASKLVPVGYGIKKLQIMMTIVDDLV 196          
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1D1_ORYSJ (Elongation factor 1-delta 1 OS=Oryza sativa subsp. japonica GN=Os07g0614500 PE=2 SV=3)

HSP 1 Score: 106.301 bits (264), Expect = 1.241e-22
Identity = 50/57 (87.72%), Postives = 54/57 (94.74%), Query Frame = 2
Query:  404 VLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDLV 574
            VLLDVKPWDDETDM KLEEAVR+V+M GL WGASKLVPVGYGIKK+QIMMTI+DDLV
Sbjct:  143 VLLDVKPWDDETDMTKLEEAVRNVKMEGLLWGASKLVPVGYGIKKLQIMMTIVDDLV 199          
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1D1_ARATH (Elongation factor 1-delta 1 OS=Arabidopsis thaliana GN=At1g30230 PE=2 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 1.241e-22
Identity = 47/57 (82.46%), Postives = 55/57 (96.49%), Query Frame = 2
Query:  404 VLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDLV 574
            VL+D+KPWDDETDMKKLEEAV+S++M GLFWGASKLVPVGYGIKK+QI+ TI+DDLV
Sbjct:  145 VLIDIKPWDDETDMKKLEEAVKSIQMEGLFWGASKLVPVGYGIKKLQILCTIVDDLV 201          
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1B_WHEAT (Elongation factor 1-beta OS=Triticum aestivum PE=1 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 3.610e-22
Identity = 48/56 (85.71%), Postives = 54/56 (96.43%), Query Frame = 2
Query:  404 VLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDL 571
            VL+D+KPWDDETDMKKLEEAVRSV+M GL WGASKL+PVGYGIKK+QIM+TIIDDL
Sbjct:  132 VLMDIKPWDDETDMKKLEEAVRSVQMEGLTWGASKLMPVGYGIKKLQIMLTIIDDL 187          

HSP 2 Score: 100.523 bits (249), Expect = 6.809e-21
Identity = 44/73 (60.27%), Postives = 62/73 (84.93%), Query Frame = 2
Query:    2 TFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSSHIAPSFPGKAVGV 220
            TFSDLHT  GLK+L+ +L+GK+YISG+ +TKDD+KV+AAV +KP+  FPNA+RWYD+V++ ++  FPG+A GV
Sbjct:    4 TFSDLHTADGLKALEAHLAGKTYISGDGITKDDVKVFAAVPLKPSAEFPNAARWYDTVAAAVSSRFPGQASGV 76          
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1D_PIMBR (Elongation factor 1-delta OS=Pimpinella brachycarpa PE=2 SV=3)

HSP 1 Score: 102.834 bits (255), Expect = 1.372e-21
Identity = 48/57 (84.21%), Postives = 53/57 (92.98%), Query Frame = 2
Query:  404 VLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDLV 574
            VLLDVKPWDDETDM KLEEAVRS++M GL WGASKLV VGYGIKK+QIM+TI+DDLV
Sbjct:  140 VLLDVKPWDDETDMTKLEEAVRSIKMDGLLWGASKLVAVGYGIKKLQIMLTIVDDLV 196          

HSP 2 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 30/60 (50.00%), Postives = 43/60 (71.67%), Query Frame = 2
Query:    2 TFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSS 181
            TF DL +E+GL+ LD+YL  +SYISG Q +KDD+ V+AA+   P+  + N SRWY+ V +
Sbjct:    4 TFYDLSSEAGLEKLDEYLLSRSYISGYQASKDDLAVHAALAKPPSSKYVNVSRWYNHVEA 63          
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Match: EF1D_BETVU (Elongation factor 1-delta OS=Beta vulgaris PE=2 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 8.893e-21
Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 2
Query:  404 VLLDVKPWDDETDMKKLEEAVRSVEMPGLFWGASKLVPVGYGIKKMQIMMTIIDDLV 574
            VLLDVKPWDDETDMKKLEEAVRSV+  GL  GASKLVPVGYGIKK+ IMMTI+DDLV
Sbjct:  145 VLLDVKPWDDETDMKKLEEAVRSVQQEGLTLGASKLVPVGYGIKKLTIMMTIVDDLV 201          
The following BLAST results are available for this feature:
BLAST of BQ623551 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
EF1B2_ARATH1.407e-5053.93Elongation factor 1-beta 2 OS=Arabidopsis thaliana... [more]
EF1B_ORYSJ5.531e-4751.83Elongation factor 1-beta OS=Oryza sativa subsp. ja... [more]
EF1B1_ARATH2.416e-2672.97Elongation factor 1-beta 1 OS=Arabidopsis thaliana... [more]
EF1D2_ARATH9.501e-2384.21Elongation factor 1-delta 2 OS=Arabidopsis thalian... [more]
EF1D2_ORYSJ1.241e-2287.72Elongation factor 1-delta 2 OS=Oryza sativa subsp.... [more]
EF1D1_ORYSJ1.241e-2287.72Elongation factor 1-delta 1 OS=Oryza sativa subsp.... [more]
EF1D1_ARATH1.241e-2282.46Elongation factor 1-delta 1 OS=Arabidopsis thalian... [more]
EF1B_WHEAT3.610e-2285.71Elongation factor 1-beta OS=Triticum aestivum PE=1... [more]
EF1D_PIMBR1.372e-2184.21Elongation factor 1-delta OS=Pimpinella brachycarp... [more]
EF1D_BETVU8.893e-2185.96Elongation factor 1-delta OS=Beta vulgaris PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00642 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00642 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623551 ID=BQ623551|Name=BQ623551|organism=Citrus sinensis|type=EST|length=604bp
CACCTTTTCAGATCTCCACACAGAGTCAGGCCTTAAGTCTCTTGATCAGT
ATCTTTCTGGGAAATCTTATATCTCCGGTAATCAACTGACAAAAGATGAC
ATCAAGGTCTACGCTGCCGTTTTGGTGAAACCTGCTGATTCTTTCCCCAA
CGCCAGCAGGTGGTACGACAGCGTTTCTTCACATATCGCCCCAAGCTTCC
CTGGCAAAGCCGTTGGTGTGAGAGTTGATGGCAAAGGTGCTCCAGTTGAC
GCCGCCGCAGCCAAGCCTGCTGCTGCTGGAGGTGGTGATGATGATGATTT
GGATCTCTTCGGAGATGAGACTGAGGAGGATAAGAAAGCAGCAGAGGAGA
GGGAGGCTGCTAAAAAGCAATCATCCAAGAAGAAAGAGAGTGGAAAATCA
TCGGTACTTTTGGATGTAAAGCCTTGGGATGACGAGACAGACATGAAAAA
GCTAGAAGAGGCAGTTAGGAGTGTTGAGATGCCGGGTCTCTTTTGGGGAG
CATCAAAATTGGTCCCAGTCGGTTATGGGATTAAGAAGATGCAGATCATG
ATGACAATCATTGATGATCTTGTTCTGTGGATTCACTCATAGAGGACACC
TCAC
back to top