BQ623588

Overview
NameBQ623588
Unique NameBQ623588
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length460
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623588_ssr196 microsatellite BQ623588_ssr196:196..207. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of BQ623588 vs. ExPASy Swiss-Prot
Match: BH068_ARATH (Transcription factor bHLH68 OS=Arabidopsis thaliana GN=BHLH68 PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 7.900e-13
Identity = 46/99 (46.46%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  220 NKSCVTSFSS--------------NMLDFTSTK-----ADARHPPPDRSSECNSTASGGVAKKARVXXXXXXXXXXXFKVRKEKLGDRITALHQLVSPF 459
            NKSCVT+ ++              NMLDF+S       ++ RH PPDRSSECNS   GG   K +             KVRKEKLG RI ALHQLVSPF
Sbjct:  186 NKSCVTTTTTTSLNSNDDNINNNNNMLDFSSNHNGLHLSEGRHTPPDRSSECNSLEIGGSTNK-KPRLQPSPSSQSTLKVRKEKLGGRIAALHQLVSPF 283          
The following BLAST results are available for this feature:
BLAST of BQ623588 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
BH068_ARATH7.900e-1346.46Transcription factor bHLH68 OS=Arabidopsis thalian... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00679 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00679 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623588 ID=BQ623588|Name=BQ623588|organism=Citrus sinensis|type=EST|length=460bp
AAAAGGTGGAGAACTGGGAAGAACAGATATTACATCACAGCTCATCAAGT
GCTAATTCTGTTGTAAATGTGAAGCAAGAAATTAATCCTGCAGCAAACAG
CTACTTTTTATGGACATGCAAATGATGATCATTTCCAGGCGGCTGCAGCA
TCAGCAGCAACAAAAACTACTTCTTGGTCTCAAGTCATGCCTCCAGCTGC
TGCTGCTTCATCTCCTAATAATAAGTCATGTGTCACAAGTTTCAGCAGCA
ACATGTTGGATTTCACTAGCACCAAAGCAGATGCAAGGCATCCGCCCCCA
GATCGATCTTCTGAGTGTAACAGCACTGCAAGTGGTGGGGTGGCCAAGAA
AGCTAGGGTTCAGTCGTCTTCTTCTTCGTCAACTCAATCAACCTTCAAGG
TGAGGAAAGAAAAACTTGGAGACCGAATCACAGCTCTTCATCAGCTAGTT
TCTCCATTTG
back to top