BQ623592

Overview
NameBQ623592
Unique NameBQ623592
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length588
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8865 contig Csv1_Contig8865:76..662. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC3_ARATH (Probable cytochrome c At4g10040 OS=Arabidopsis thaliana GN=At4g10040 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.832e-54
Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANK+MAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+ TA
Sbjct:   25 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKSMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGTA 112          

HSP 2 Score: 50.447 bits (119), Expect = 1.832e-54
Identity = 22/24 (91.67%), Postives = 23/24 (95.83%), Query Frame = 1
Query:   13 MASFDEAPPGNAKAGEKIFKTKCA 84
            MASFDEAPPGN KAGEKIF+TKCA
Sbjct:    1 MASFDEAPPGNPKAGEKIFRTKCA 24          
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC_ABUTH (Cytochrome c OS=Abutilon theophrasti PE=1 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.173e-53
Identity = 85/88 (96.59%), Postives = 86/88 (97.73%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNW E TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+STA
Sbjct:   24 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZSTA 111          

HSP 2 Score: 48.1358 bits (113), Expect = 1.173e-53
Identity = 20/23 (86.96%), Postives = 22/23 (95.65%), Query Frame = 1
Query:   16 ASFDEAPPGNAKAGEKIFKTKCA 84
            ASF +APPG+AKAGEKIFKTKCA
Sbjct:    1 ASFQZAPPGBAKAGEKIFKTKCA 23          
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC_CUCMA (Cytochrome c OS=Cucurbita maxima PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 4.415e-53
Identity = 83/88 (94.32%), Postives = 86/88 (97.73%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTV+KGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKN AV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK++TA
Sbjct:   24 QCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNRAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATA 111          

HSP 2 Score: 50.447 bits (119), Expect = 4.415e-53
Identity = 22/23 (95.65%), Postives = 23/23 (100.00%), Query Frame = 1
Query:   16 ASFDEAPPGNAKAGEKIFKTKCA 84
            ASFDEAPPGN+KAGEKIFKTKCA
Sbjct:    1 ASFDEAPPGNSKAGEKIFKTKCA 23          
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC_SAMNI (Cytochrome c OS=Sambucus nigra PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 5.756e-53
Identity = 86/88 (97.73%), Postives = 87/88 (98.86%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA
Sbjct:   24 QCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 111          

HSP 2 Score: 45.0542 bits (105), Expect = 5.756e-53
Identity = 20/22 (90.91%), Postives = 20/22 (90.91%), Query Frame = 1
Query:   16 ASFDEAPPGNAKAGEKIFKTKC 81
            ASF EAPPGN KAGEKIFKTKC
Sbjct:    1 ASFAEAPPGNPKAGEKIFKTKC 22          
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC_BRAOL (Cytochrome c OS=Brassica oleracea PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.662e-52
Identity = 82/88 (93.18%), Postives = 85/88 (96.59%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYSAANKN AV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK++TA
Sbjct:   24 QCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATA 111          

HSP 2 Score: 50.447 bits (119), Expect = 1.662e-52
Identity = 22/23 (95.65%), Postives = 23/23 (100.00%), Query Frame = 1
Query:   16 ASFDEAPPGNAKAGEKIFKTKCA 84
            ASFDEAPPGN+KAGEKIFKTKCA
Sbjct:    1 ASFDEAPPGNSKAGEKIFKTKCA 23          
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC_BRANA (Cytochrome c OS=Brassica napus PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.662e-52
Identity = 82/88 (93.18%), Postives = 85/88 (96.59%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYSAANKN AV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK++TA
Sbjct:   24 QCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATA 111          

HSP 2 Score: 50.447 bits (119), Expect = 1.662e-52
Identity = 22/23 (95.65%), Postives = 23/23 (100.00%), Query Frame = 1
Query:   16 ASFDEAPPGNAKAGEKIFKTKCA 84
            ASFDEAPPGN+KAGEKIFKTKCA
Sbjct:    1 ASFDEAPPGNSKAGEKIFKTKCA 23          
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC2_ARATH (Probable cytochrome c At1g22840 OS=Arabidopsis thaliana GN=At1g22840 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.662e-52
Identity = 82/88 (93.18%), Postives = 83/88 (94.32%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTVE GAGHKQGPNLNGLFGRQSGTT GYSYSAANKN AV WEEK LYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+STA
Sbjct:   25 QCHTVEAGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWEEKALYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 112          

HSP 2 Score: 52.373 bits (124), Expect = 1.662e-52
Identity = 23/24 (95.83%), Postives = 24/24 (100.00%), Query Frame = 1
Query:   13 MASFDEAPPGNAKAGEKIFKTKCA 84
            MASFDEAPPGNAKAGEKIF+TKCA
Sbjct:    1 MASFDEAPPGNAKAGEKIFRTKCA 24          
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC_PHAAU (Cytochrome c OS=Phaseolus aureus PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.167e-52
Identity = 83/88 (94.32%), Postives = 85/88 (96.59%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYS ANKNMAV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+STA
Sbjct:   24 QCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSTANKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 111          

HSP 2 Score: 49.2914 bits (116), Expect = 2.167e-52
Identity = 21/23 (91.30%), Postives = 23/23 (100.00%), Query Frame = 1
Query:   16 ASFDEAPPGNAKAGEKIFKTKCA 84
            ASFDEAPPGN+K+GEKIFKTKCA
Sbjct:    1 ASFDEAPPGNSKSGEKIFKTKCA 23          
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC_RICCO (Cytochrome c OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.064e-51
Identity = 82/88 (93.18%), Postives = 84/88 (95.45%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTVEKGAGHKQGPNLNGLFGRQSGTT GYSYSAANKNMAV W E TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK++TA
Sbjct:   24 QCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVQWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZATA 111          

HSP 2 Score: 48.1358 bits (113), Expect = 1.064e-51
Identity = 19/23 (82.61%), Postives = 22/23 (95.65%), Query Frame = 1
Query:   16 ASFDEAPPGNAKAGEKIFKTKCA 84
            ASF++APPG+ KAGEKIFKTKCA
Sbjct:    1 ASFBZAPPGBVKAGEKIFKTKCA 23          
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Match: CYC_GOSBA (Cytochrome c OS=Gossypium barbadense PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.064e-51
Identity = 82/88 (93.18%), Postives = 84/88 (95.45%), Query Frame = 2
Query:   86 QCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 349
            QCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYSAANKNMAV W E TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+STA
Sbjct:   24 QCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVQWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZSTA 111          

HSP 2 Score: 48.1358 bits (113), Expect = 1.064e-51
Identity = 20/23 (86.96%), Postives = 22/23 (95.65%), Query Frame = 1
Query:   16 ASFDEAPPGNAKAGEKIFKTKCA 84
            ASF +APPG+AKAGEKIFKTKCA
Sbjct:    1 ASFQZAPPGBAKAGEKIFKTKCA 23          
The following BLAST results are available for this feature:
BLAST of BQ623592 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
CYC3_ARATH1.832e-5496.59Probable cytochrome c At4g10040 OS=Arabidopsis tha... [more]
CYC_ABUTH1.173e-5396.59Cytochrome c OS=Abutilon theophrasti PE=1 SV=1[more]
CYC_CUCMA4.415e-5394.32Cytochrome c OS=Cucurbita maxima PE=1 SV=1[more]
CYC_SAMNI5.756e-5397.73Cytochrome c OS=Sambucus nigra PE=1 SV=1[more]
CYC_BRAOL1.662e-5293.18Cytochrome c OS=Brassica oleracea PE=1 SV=1[more]
CYC_BRANA1.662e-5293.18Cytochrome c OS=Brassica napus PE=1 SV=1[more]
CYC2_ARATH1.662e-5293.18Probable cytochrome c At1g22840 OS=Arabidopsis tha... [more]
CYC_PHAAU2.167e-5294.32Cytochrome c OS=Phaseolus aureus PE=1 SV=1[more]
CYC_RICCO1.064e-5193.18Cytochrome c OS=Ricinus communis PE=1 SV=1[more]
CYC_GOSBA1.064e-5193.18Cytochrome c OS=Gossypium barbadense PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00683 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00683 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623592 ID=BQ623592|Name=BQ623592|organism=Citrus sinensis|type=EST|length=588bp
AACACCACAATAATGGCGTCGTTTGATGAGGCACCTCCCGGCAATGCAAA
GGCCGGAGAGAAGATCTTCAAGACCAAGTGCGCCTCAGTGCCACACCGTC
GAGAAAGGCGCCGGTCACAAACAAGGTCCTAATTTGAACGGATTGTTTGG
AAGGCAATCGGGGACTACACCTGGGTACTCATACTCTGCGGCTAACAAGA
ACATGGCTGTGAATTGGGAGGAAAAGACTTTGTATGATTACTTGCTCAAC
CCTAAGAAGTACATTCCTGGAACAAAGATGGTATTCCCTGGATTGAAGAA
GCCTCAGGATCGTGCCGACCTTATTGCATATTTGAAACAATCTACTGCAT
AAGAACTTGCCGATAGTCAGTTTACCTATTCCATTTTGCAGTTGTTGAAG
ATTGTTTTGCGGTGCGGATATAGTACTGTTTTTTACCAATAAATTTTAAA
CATTTAAGGTTCAGCAATGTTCTTTGTAACTTGAGCATTGCTAATTTGAG
AAAAGGTTGCTGTCATTGGCAAACATAATATTCAATTGAATTTCCTGGTT
ATAATCATATTTCATGAATTTTGGGTGAAAAAAAAAAA
back to top