BQ623600

Overview
NameBQ623600
Unique NameBQ623600
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length575
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1001 contig Csv1_Contig1001:853..1427. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_BETVU (Elongation factor 2 OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.056e-61
Identity = 114/127 (89.76%), Postives = 121/127 (95.28%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            SQLTAKPRLLEPVY+VEIQAPE ALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPV+ESFGFS TLRA+TSGQAFPQCVFDHW+MM SDPLE G+QA+ LV+ IRKRKGLKEQMTPLSEFEDKL
Sbjct:  717 SQLTAKPRLLEPVYLVEIQAPENALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRASTSGQAFPQCVFDHWEMMPSDPLEAGSQASTLVSVIRKRKGLKEQMTPLSEFEDKL 843          
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_CHLKE (Elongation factor 2 OS=Chlorella kessleri PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 7.832e-53
Identity = 97/127 (76.38%), Postives = 113/127 (88.98%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            +QLTA+PRLLEPVY+VEIQ PEQA+GG+YSVLNQKRG VFEE+QRPGTP++N+KAYLPVIESFGF+ TLRAAT+GQAFPQCVFDHW+ M SDP + G+QA  LV DIRKRKGLK +   LSE+EDKL
Sbjct:  719 AQLTAQPRLLEPVYLVEIQCPEQAMGGVYSVLNQKRGMVFEELQRPGTPIFNLKAYLPVIESFGFTSTLRAATAGQAFPQCVFDHWEAMGSDPTQVGSQANTLVMDIRKRKGLKPEPAALSEYEDKL 845          
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_CAEEL (Elongation factor 2 OS=Caenorhabditis elegans GN=eft-2 PE=2 SV=4)

HSP 1 Score: 175.252 bits (443), Expect = 1.934e-43
Identity = 83/127 (65.35%), Postives = 100/127 (78.74%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            S LTA+PRLLEPVY+VEIQ PE A+GGIY VLN++RGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DPLE GT+  Q+V D RKRKGLKE +  L  + DK+
Sbjct:  726 SVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVTGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKPNQIVLDTRKRKGLKEGVPALDNYLDKM 852          
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_SCHPO (Elongation factor 2 OS=Schizosaccharomyces pombe GN=eft1 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 1.253e-42
Identity = 83/127 (65.35%), Postives = 99/127 (77.95%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            S L A P + EPV++VEIQ  E A+GGIYSVLN+KRGHVF E QR GTPLYNIKAYLPV ESFGF+G LR AT+GQAFPQ VFDHW  MS DPL+P ++  Q+V + RKRKGLKE +   +E+ D+L
Sbjct:  716 STLLASPIIQEPVFLVEIQVSENAMGGIYSVLNKKRGHVFSEEQRVGTPLYNIKAYLPVNESFGFTGELRQATAGQAFPQLVFDHWSPMSGDPLDPTSKPGQIVCEARKRKGLKENVPDYTEYYDRL 842          
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_CRIGR (Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=3 SV=3)

HSP 1 Score: 172.555 bits (436), Expect = 1.253e-42
Identity = 80/127 (62.99%), Postives = 100/127 (78.74%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            S LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  732 SVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRGSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_RAT (Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4)

HSP 1 Score: 172.17 bits (435), Expect = 1.637e-42
Identity = 80/127 (62.99%), Postives = 100/127 (78.74%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            S LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  732 SVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_PONAB (Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3)

HSP 1 Score: 172.17 bits (435), Expect = 1.637e-42
Identity = 80/127 (62.99%), Postives = 100/127 (78.74%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            S LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  732 SVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_MOUSE (Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 1.637e-42
Identity = 80/127 (62.99%), Postives = 100/127 (78.74%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            S LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  732 SVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_MESAU (Elongation factor 2 OS=Mesocricetus auratus GN=EEF2 PE=2 SV=3)

HSP 1 Score: 172.17 bits (435), Expect = 1.637e-42
Identity = 80/127 (62.99%), Postives = 100/127 (78.74%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            S LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  732 SVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Match: EF2_HUMAN (Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4)

HSP 1 Score: 172.17 bits (435), Expect = 1.637e-42
Identity = 80/127 (62.99%), Postives = 100/127 (78.74%), Query Frame = 2
Query:    2 SQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 382
            S LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  732 SVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
The following BLAST results are available for this feature:
BLAST of BQ623600 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
EF2_BETVU2.056e-6189.76Elongation factor 2 OS=Beta vulgaris PE=2 SV=1[more]
EF2_CHLKE7.832e-5376.38Elongation factor 2 OS=Chlorella kessleri PE=2 SV=... [more]
EF2_CAEEL1.934e-4365.35Elongation factor 2 OS=Caenorhabditis elegans GN=e... [more]
EF2_SCHPO1.253e-4265.35Elongation factor 2 OS=Schizosaccharomyces pombe G... [more]
EF2_CRIGR1.253e-4262.99Elongation factor 2 OS=Cricetulus griseus GN=EEF2 ... [more]
EF2_RAT1.637e-4262.99Elongation factor 2 OS=Rattus norvegicus GN=Eef2 P... [more]
EF2_PONAB1.637e-4262.99Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 S... [more]
EF2_MOUSE1.637e-4262.99Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 S... [more]
EF2_MESAU1.637e-4262.99Elongation factor 2 OS=Mesocricetus auratus GN=EEF... [more]
EF2_HUMAN1.637e-4262.99Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00691 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00691 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623600 ID=BQ623600|Name=BQ623600|organism=Citrus sinensis|type=EST|length=575bp
TTCCCAGCTCACAGCCAAGCCCAGGCTTCTTGAGCCTGTCTACATGGTCG
AAATACAGGCTCCCGAGCAGGCCCTTGGTGGTATTTACAGTGTTCTCAAT
CAGAAACGTGGTCACGTGTTCGAGGAAATGCAGAGACCTGGTACCCCCCT
TTACAACATCAAGGCTTACCTTCCCGTCATCGAGTCCTTTGGATTCTCAG
GCACTTTGAGGGCTGCAACGTCAGGACAGGCCTTCCCACAATGTGTGTTT
GATCACTGGGACATGATGTCATCCGATCCACTGGAGCCTGGTACACAGGC
TGCACAGCTTGTTGCTGATATCAGGAAGAGGAAGGGCTTGAAGGAGCAAA
TGACACCACTATCTGAGTTTGAGGACAAGCTGTAAACATTTCGTCTTGAC
ATCAAGGGTGAGATTGCGCAGCTTGTTGCTGATATCAGGAAGAGGGAGCA
AATGACACCGCTATCCGAGTAGAGGACGAGCTGTAAACATTTCATCTTGA
CATCAAGGGTGAGATTGCGCAGCAATATTTTTTGCTGATGCTTATTTTTG
TTTCAAAGTTTTTCAATATCCTCAT
back to top