BQ623607

Overview
NameBQ623607
Unique NameBQ623607
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length578
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623607_ssr104 microsatellite BQ623607_ssr104:104..118. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of BQ623607 vs. ExPASy Swiss-Prot
Match: PRF1_SOLLC (36.4 kDa proline-rich protein OS=Solanum lycopersicum GN=TPRP-F1 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.011e-17
Identity = 44/83 (53.01%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  161 IDTLKLGACVDVLGGLVHIGIGSSAKDACCPVLQGXXXXXXXXXXXXXXXXXXXXXXXXXPIALEVLI-DCGKHPPPGFQCPA 406
            ID LKLGACVDVLGGL+HIGIG SAK  CCP+L G                         PIAL+VLI DCGK+PP  F+CP+
Sbjct:  263 IDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLGGLVDLDAAICLCTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKCPS 345          
The following BLAST results are available for this feature:
BLAST of BQ623607 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PRF1_SOLLC7.011e-1753.0136.4 kDa proline-rich protein OS=Solanum lycopersi... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00698 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00698 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623607 ID=BQ623607|Name=BQ623607|organism=Citrus sinensis|type=EST|length=578bp
TTATACCCCCAGCCCTACCCCACCATATGTACCATCACCACCGTATACCC
CAAGCCCTACCCCGCCATATGTACCATCACCACCGTATACCCCAAGCCCT
AGCCCACCACCACCACCAAGTGGAACACCGTGTCCTCCGCCGCCGCCACC
AACTTGTCCCATTGATACTCTCAAGCTTGGTGCATGCGTCGACGTGTTGG
GTGGTCTAGTACACATCGGTATAGGCAGCAGTGCAAAGGACGCTTGCTGC
CCCGTGCTGCAGGGGCTACTGGACTTGGATGCTGCATTATGTCTTTGCAC
CACCATTAAACTTAAGCTTTTGAATATCAATCTTATTATACCGATCGCCC
TTGAAGTGCTTATTGACTGCGGCAAGCATCCGCCGCCCGGATTCCAGTGT
CCTGCCTAATTGGTGACGCTTTCCAGCCATGCAATTGATGAATGCGACTT
GTTTGTTTTGGAGATTTTGTCAAAGATAATGACATGTAAGTGCATAAAGT
GGAAGTACTTCATGATATCGAAGTTTGGCTTAATATATGTTTTGGTCCTC
TTGGGCATATCAAACCAATTATCTTTGG
back to top