BQ623925
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623925 vs. ExPASy Swiss-Prot
Match: SCP24_ARATH (Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 1.017e-15 Identity = 38/42 (90.48%), Postives = 42/42 (100.00%), Query Frame = 2 Query: 2 EVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQLPKS 127 EVYKGLTFATVRGAGHEVPLF+P+RALILFRSFLAGK+LP+S Sbjct: 423 EVYKGLTFATVRGAGHEVPLFEPKRALILFRSFLAGKELPRS 464
BLAST of BQ623925 vs. ExPASy Swiss-Prot
Match: SCP23_ARATH (Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2) HSP 1 Score: 72.7886 bits (177), Expect = 6.173e-13 Identity = 33/42 (78.57%), Postives = 38/42 (90.48%), Query Frame = 2 Query: 2 EVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQLPKS 127 EVY+GLTFAT+RGAGHEVP+ QP RAL L RSFLAGK+LP+S Sbjct: 412 EVYEGLTFATIRGAGHEVPVLQPERALTLLRSFLAGKELPRS 453
BLAST of BQ623925 vs. ExPASy Swiss-Prot
Match: SCP22_ARATH (Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.164e-11 Identity = 32/42 (76.19%), Postives = 36/42 (85.71%), Query Frame = 2 Query: 2 EVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQLPKS 127 EVY+GLTF TVRGAGHEVP FQP+ ALIL RSFLAG +L +S Sbjct: 422 EVYEGLTFVTVRGAGHEVPFFQPQSALILLRSFLAGNELSRS 463
BLAST of BQ623925 vs. ExPASy Swiss-Prot
Match: SCP25_ARATH (Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 4.424e-11 Identity = 31/42 (73.81%), Postives = 35/42 (83.33%), Query Frame = 2 Query: 2 EVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQLPKS 127 EVY+GLTF TVRGAGHEVPLF+PR A LF+ FL GK LPK+ Sbjct: 432 EVYEGLTFVTVRGAGHEVPLFKPRAAFELFKYFLRGKPLPKA 473 The following BLAST results are available for this feature:
BLAST of BQ623925 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623925 ID=BQ623925; Name=BQ623925; organism=Citrus sinensis; type=EST; length=383bpback to top |