CA588038

Overview
NameCA588038
Unique NameCA588038
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CA588038 vs. ExPASy Swiss-Prot
Match: Y5713_ARATH (PI-PLC X domain-containing protein At5g67130 OS=Arabidopsis thaliana GN=At5g67130 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.056e-12
Identity = 28/57 (49.12%), Postives = 39/57 (68.42%), Query Frame = 3
Query:    6 TCYEAAGKRWPNFIAVNYYKRSDGGGAPETVDVANGRLVCGCGNIAYCKANMTYGAC 176
            TC ++ G R PNF+AVN+Y RSDGGG  E +D  NG ++CGC  ++ C+    YG+C
Sbjct:  312 TCLKSGGNRMPNFLAVNFYMRSDGGGVFEILDRMNGPVLCGCETLSACQPGAAYGSC 368          
The following BLAST results are available for this feature:
BLAST of CA588038 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y5713_ARATH3.056e-1249.12PI-PLC X domain-containing protein At5g67130 OS=Ar... [more]
back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1413 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD5.2 5 similar to MAP3K-like protein kinase [Arabidopsis thaliana] (CAB16796), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588038 ID=CA588038|Name=CA588038|organism=Citrus sinensis|type=EST|length=412bp
TGAACACATGTTACGAAGCTGCAGGCAAAAGATGGCCTAATTTCATCGCA
GTTAACTATTACAAGAGAAGTGATGGCGGGGGAGCACCGGAAACCGTAGA
CGTGGCCAACGGTCGTTTGGTTTGCGGGTGTGGAAACATCGCCTATTGCA
AGGCGAATATGACTTATGGAGCATGCGATTCGCCAGAGCCTGGTGTCACC
CCGGCTTCACCAGCACATCAACCCAACTCTGCATTTTCAAGTAGAAGATC
AGTTCAATTATGGACGCGGTGGTTGCTTTGTGCAGCCCTGTTGACAATTC
TTTGGACATTGTAAATCAGTTGTGGTTTTAGTGCTTCTTAAAACTCGAAG
TGTTTTGCCATTTTAACCAATAGATAAGTTTTGTGGGATGGTTTGAAAGA
AACAAGTGATTT
back to top