CA588039

Overview
NameCA588039
Unique NameCA588039
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length516
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CA588039_ssr504 microsatellite CA588039_ssr504:504..515. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3711 contig Csv1_Contig3711:1141..1656. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB_SOLTU (Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 5.205e-36
Identity = 69/75 (92.00%), Postives = 73/75 (97.33%), Query Frame = 3
Query:    3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL 227
            FSISGRLLF GYSNGDCYVWDTLLAKVVLNLGS+QNSHEGRI+CLGLSADGSALCTGSWDTNLKIWAFGG+R V+
Sbjct:  303 FSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGSVQNSHEGRISCLGLSADGSALCTGSWDTNLKIWAFGGHRSVV 377          
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB2_TOBAC (Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 8.878e-36
Identity = 68/75 (90.67%), Postives = 73/75 (97.33%), Query Frame = 3
Query:    3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL 227
            FSISGRLLF GYSNGDCYVWDTLLAKVVLNLG++QNSHEGRI+CLGLSADGSALCTGSWDTNLKIWAFGG+R V+
Sbjct:  303 FSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGAVQNSHEGRISCLGLSADGSALCTGSWDTNLKIWAFGGHRSVI 377          
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB1_TOBAC (Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.160e-35
Identity = 68/75 (90.67%), Postives = 72/75 (96.00%), Query Frame = 3
Query:    3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL 227
            FSISGRLLF GYSNGDCYVWDTLLAKVVLNLG +QNSHEGRI+CLGLSADGSALCTGSWDTNLKIWAFGG+R V+
Sbjct:  303 FSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGGVQNSHEGRISCLGLSADGSALCTGSWDTNLKIWAFGGHRSVI 377          
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB_ORYSJ (Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. japonica GN=Os03g0669200 PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.674e-34
Identity = 65/75 (86.67%), Postives = 73/75 (97.33%), Query Frame = 3
Query:    3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL 227
            FSISGRLLFAGYSNGDCYVWDTLLA+VVLNLG+LQNSHEGRI+CLGLS+DGSALCTGSWD NLKIWAF G+R+++
Sbjct:  306 FSISGRLLFAGYSNGDCYVWDTLLAEVVLNLGNLQNSHEGRISCLGLSSDGSALCTGSWDKNLKIWAFSGHRKIV 380          
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB3_TOBAC (Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 2.856e-34
Identity = 66/70 (94.29%), Postives = 68/70 (97.14%), Query Frame = 3
Query:    3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGG 212
            FSISGRLLF GYSNGDCYVWDTLLAKVVLNLG +QNSHEGRI+CLGLSADGSALCTGSWDTNLKIWAFGG
Sbjct:  303 FSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGGVQNSHEGRISCLGLSADGSALCTGSWDTNLKIWAFGG 372          
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB_MAIZE (Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 6.363e-34
Identity = 63/75 (84.00%), Postives = 73/75 (97.33%), Query Frame = 3
Query:    3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL 227
            FSISGRLLFAGYSNGDCYVWDTLLA+VVLNLG+LQNSH+GRI+CLG+S+DGSALCTGSWD NLKIWAF G+R+++
Sbjct:  306 FSISGRLLFAGYSNGDCYVWDTLLAEVVLNLGNLQNSHDGRISCLGMSSDGSALCTGSWDKNLKIWAFSGHRKIV 380          
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB_NICPL (Guanine nucleotide-binding protein subunit beta OS=Nicotiana plumbaginifolia PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 5.386e-33
Identity = 64/75 (85.33%), Postives = 69/75 (92.00%), Query Frame = 3
Query:    3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL 227
            FSISGRLLF  YSNGDCYVWDTLLAKVVLNLG++QNSHEG I+CLGLSADG  LCTGSWDTNLKIWAFGG+R V+
Sbjct:  303 FSISGRLLFVRYSNGDCYVWDTLLAKVVLNLGAVQNSHEGXISCLGLSADGXXLCTGSWDTNLKIWAFGGHRSVI 377          
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB_ARATH (Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.118e-29
Identity = 60/76 (78.95%), Postives = 68/76 (89.47%), Query Frame = 3
Query:    3 FSISGRLLFAGY-SNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL 227
            FS+SGRLLFAGY SN  CYVWDTLL +VVL+LG  Q+SH  RI+CLGLSADGSALCTGSWD+NLKIWAFGG+RRV+
Sbjct:  302 FSVSGRLLFAGYASNNTCYVWDTLLGEVVLDLGLQQDSHRNRISCLGLSADGSALCTGSWDSNLKIWAFGGHRRVI 377          
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB_DICDI (Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.274e-15
Identity = 39/67 (58.21%), Postives = 46/67 (68.66%), Query Frame = 3
Query:    3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWA 203
            FS SGR LFAGY +  C VWDTL  + VL+L      H  R++CLG+  DG ALCTGSWD+ LKIWA
Sbjct:  285 FSFSGRFLFAGYDDFTCNVWDTLKGERVLSL----TGHGNRVSCLGVPTDGMALCTGSWDSLLKIWA 347          
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB_CRYPA (Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 6.615e-15
Identity = 39/67 (58.21%), Postives = 49/67 (73.13%), Query Frame = 3
Query:    6 SISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAF 206
            S+SGRLLFAGY + +C VWD    + V   GSL   HE R++CLG+S DG +LCTGSWD+ LKIWA+
Sbjct:  297 SVSGRLLFAGYDDFECKVWDVTRGEKV---GSLVG-HENRVSCLGVSNDGISLCTGSWDSLLKIWAY 359          
The following BLAST results are available for this feature:
BLAST of CA588039 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
GBB_SOLTU5.205e-3692.00Guanine nucleotide-binding protein subunit beta OS... [more]
GBB2_TOBAC8.878e-3690.67Guanine nucleotide-binding protein subunit beta-2 ... [more]
GBB1_TOBAC1.160e-3590.67Guanine nucleotide-binding protein subunit beta-1 ... [more]
GBB_ORYSJ1.674e-3486.67Guanine nucleotide-binding protein subunit beta OS... [more]
GBB3_TOBAC2.856e-3494.29Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_MAIZE6.363e-3484.00Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_NICPL5.386e-3385.33Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_ARATH2.118e-2978.95Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_DICDI2.274e-1558.21Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_CRYPA6.615e-1558.21Guanine nucleotide-binding protein subunit beta OS... [more]

Pages

back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1409 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD3.1 5 similar to G protein beta subunit [Pisum sativum](AF170921), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588039 ID=CA588039|Name=CA588039|organism=Citrus sinensis|type=EST|length=516bp
CATTCTCCATATCGGGAAGGCTTCTTTTTGCCGGATACTCAAATGGTGAT
TGTTATGTGTGGGACACATTATTAGCAAAGGTTGTATTGAACTTGGGATC
TCTCCAGAACTCACATGAGGGCCGGATCACCTGTTTGGGTTTGTCAGCCG
ATGGAAGTGCCTTATGTACAGGAAGTTGGGACACAAACCTAAAGATTTGG
GCTTTTGGAGGGTACAGGAGGGTGCTCTGAGTCCTTGGGGAGTGAAAGGC
TTGTGAATCCTCTCTTAAATCTCAGGTTCTGGCTTACGTCATTTTGCTGC
TTCTTGCTTCCTTGATAGATTCCTTTGTATTTTTAGCTAGTTAATGTGGT
TTGAGAAATTGTAATCATCTGCTGTGGCTTCTTGTAATCTCCATGTGAAA
CACTGACCTTTTGACTAGGTGAAAAAAAAAAAAGAAAAAAAAATTGTTCG
AGAATCTGAACTAGTAGAAGCAGCAATTCAGTTGTTTCCACTTTCTCAGT
TTTTCTCTCTCTCTCT
back to top