CA588040

Overview
NameCA588040
Unique NameCA588040
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length472
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CA588040 vs. ExPASy Swiss-Prot
Match: SMC22_ARATH (Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 2.763e-56
Identity = 106/156 (67.95%), Postives = 136/156 (87.18%), Query Frame = 3
Query:    3 GEVKALSGKVDALSQDLVREVSVLNNKDDTLRSGKENAEKIVRNIEDLKQAIEEKVSAVRKCEEGAADLKKKFEELSKGLEENEKEYQGVLAGKSSGNEEKCLEDQLADAKVTVGSAETELKQLKTKISHCEKDLKEKTQQFMSKREEAVSVESEL 470
            GEVKALS KVD+LS ++ RE+S L N +DTL+  ++NAEK+V NIEDLK+++EE+ SA+ KC+EGAA+LK+KF+E S  LEE E+E+QG+LAGKSSG+EEKCLEDQL DAK++VG+AETELKQL TKISHCEK+LKEK  Q MSK++EAV+VE+EL
Sbjct:  294 GEVKALSDKVDSLSNEVTRELSKLTNMEDTLQGEEKNAEKMVHNIEDLKKSVEERASALNKCDEGAAELKQKFQEFSTTLEECEREHQGILAGKSSGDEEKCLEDQLRDAKISVGTAETELKQLNTKISHCEKELKEKKSQLMSKQDEAVAVENEL 449          
BLAST of CA588040 vs. ExPASy Swiss-Prot
Match: SMC21_ARATH (Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2)

HSP 1 Score: 214.927 bits (546), Expect = 1.371e-55
Identity = 108/156 (69.23%), Postives = 132/156 (84.62%), Query Frame = 3
Query:    3 GEVKALSGKVDALSQDLVREVSVLNNKDDTLRSGKENAEKIVRNIEDLKQAIEEKVSAVRKCEEGAADLKKKFEELSKGLEENEKEYQGVLAGKSSGNEEKCLEDQLADAKVTVGSAETELKQLKTKISHCEKDLKEKTQQFMSKREEAVSVESEL 470
            GEVK LS KVD+L+Q++ RE S LNNK+DTL   KEN EKIV +IEDLK++++E+ +AV+K EEGAADLK++F+ELS  LEE EKE+QGVLAGKSSG+EEKCLEDQL DAK+ VG+A TELKQLKTKI HCEK+LKE+  Q MSK EEA+ VE+EL
Sbjct:  294 GEVKTLSEKVDSLAQEMTRESSKLNNKEDTLLGEKENVEKIVHSIEDLKKSVKERAAAVKKSEEGAADLKQRFQELSTTLEECEKEHQGVLAGKSSGDEEKCLEDQLRDAKIAVGTAGTELKQLKTKIEHCEKELKERKSQLMSKLEEAIEVENEL 449          
The following BLAST results are available for this feature:
BLAST of CA588040 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
SMC22_ARATH2.763e-5667.95Structural maintenance of chromosomes protein 2-2 ... [more]
SMC21_ARATH1.371e-5569.23Structural maintenance of chromosomes protein 2-1 ... [more]
back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1597 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD9.1 5 similar to SMC2-like condensin [Arabidopsis thaliana](AF271731), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588040 ID=CA588040|Name=CA588040|organism=Citrus sinensis|type=EST|length=472bp
GTGGGGAAGTAAAAGCTTTATCGGGAAAAGTAGATGCACTATCGCAAGAT
CTTGTGCGCGAAGTATCTGTATTAAATAATAAGGATGACACTCTCAGGAG
TGGGAAAGAAAATGCTGAAAAGATTGTTCGTAATATTGAAGACTTGAAGC
AAGCTATAGAAGAGAAGGTCTCTGCTGTAAGAAAGTGTGAAGAAGGAGCA
GCCGATCTCAAAAAGAAATTTGAGGAACTTTCAAAGGGTTTGGAGGAAAA
TGAAAAAGAATACCAGGGAGTATTAGCTGGTAAGAGTAGTGGAAATGAGG
AGAAATGCCTTGAAGACCAGCTAGCTGATGCCAAAGTTACTGTTGGGAGT
GCTGAAACAGAGTTGAAACAGCTGAAAACGAAAATAAGCCATTGTGAGAA
GGACCTGAAAGAGAAAACACAACAGTTCATGTCAAAACGTGAGGAAGCTG
TTTCTGTGGAGAGTGAGCTGAA
back to top