CA588050

Overview
NameCA588050
Unique NameCA588050
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length245
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CA588050 vs. ExPASy Swiss-Prot
Match: SMC22_ARATH (Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.452e-14
Identity = 45/81 (55.56%), Postives = 59/81 (72.84%), Query Frame = 3
Query:    3 GEVKALSGKVDALSQDLVREVSVLNN*DDTLRSEKENAEKIVRNI*RLEASYRREGLSAVRKCLELAADLKKKFEELSKGL 245
            GEVKALS KVD+LS ++ RE+S L N +DTL+ E++NAEK+V NI  L+ S   E  SA+ KC E AA+LK+KF+E S  L
Sbjct:  294 GEVKALSDKVDSLSNEVTRELSKLTNMEDTLQGEEKNAEKMVHNIEDLKKSV-EERASALNKCDEGAAELKQKFQEFSTTL 373          
BLAST of CA588050 vs. ExPASy Swiss-Prot
Match: SMC21_ARATH (Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 1.452e-14
Identity = 46/81 (56.79%), Postives = 59/81 (72.84%), Query Frame = 3
Query:    3 GEVKALSGKVDALSQDLVREVSVLNN*DDTLRSEKENAEKIVRNI*RLEASYRREGLSAVRKCLELAADLKKKFEELSKGL 245
            GEVK LS KVD+L+Q++ RE S LNN +DTL  EKEN EKIV +I  L+ S  +E  +AV+K  E AADLK++F+ELS  L
Sbjct:  294 GEVKTLSEKVDSLAQEMTRESSKLNNKEDTLLGEKENVEKIVHSIEDLKKSV-KERAAAVKKSEEGAADLKQRFQELSTTL 373          
The following BLAST results are available for this feature:
BLAST of CA588050 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
SMC22_ARATH1.452e-1455.56Structural maintenance of chromosomes protein 2-2 ... [more]
SMC21_ARATH1.452e-1456.79Structural maintenance of chromosomes protein 2-1 ... [more]
back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1482 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD14.2 5 similar to chromosome assembly protein homolog [Arabidopsis thaliana] (AL132955), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588050 ID=CA588050|Name=CA588050|organism=Citrus sinensis|type=EST|length=245bp
GTGGGGAAGTAAAAGCTTTATCGGGAAAAGTAGATGCACTATCGCAAGAT
CTTGTGCGCGAAGTATCTGTATTAAATAATTAGGATGACACTCTCAGGAG
TGAGAAAGAAAATGCTGAAAAGATTGTTCGTAATATTTGAAGACTTGAAG
CAAGCTATAGAAGAGAAGGTCTCTCTGCTGTTAGAAAGTGTTTAGAATTA
GCAGCCGATCTCAAAAAGAAATTTGAGGAACTTTCAAAGGGTTTG
back to top