CB250264

Overview
NameCB250264
Unique NameCB250264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length301
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig111 contig Csv1_Contig111:1..301. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA1_ARATH (Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3)

HSP 1 Score: 145.206 bits (365), Expect = 9.750e-35
Identity = 73/100 (73.00%), Postives = 81/100 (81.00%), Query Frame = 1
Query:    1 KEVDNSKGTPAFGSSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGGFR 300
            KEV+       F S IP +A KLLLQSIF NTGGE+V+G+GNKTEILGTPTETA+LEFGL LGGDFQ  RQAS +VKVEPFNS KK+MGVVIELPE  FR
Sbjct:  478 KEVNGPDAAMKFASGIPESAVKLLLQSIFTNTGGEIVVGKGNKTEILGTPTETALLEFGLSLGGDFQEVRQASNVVKVEPFNSTKKRMGVVIELPERHFR 577          
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA7_ARATH (Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=2 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 1.721e-31
Identity = 68/95 (71.58%), Postives = 77/95 (81.05%), Query Frame = 1
Query:   10 DNSKGTPAFGSSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGG 294
            D +  + +  S IP AA KLLLQ IFNNTGGEVV+ E  KTEILGTPTETAILE GL LGG FQ ERQ++K++KVEPFNS KK+MGVVIELPEGG
Sbjct:  478 DVASKSSSLQSDIPEAALKLLLQLIFNNTGGEVVVNERGKTEILGTPTETAILELGLSLGGKFQEERQSNKVIKVEPFNSTKKRMGVVIELPEGG 572          
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA2_ARATH (Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 5.537e-30
Identity = 63/85 (74.12%), Postives = 73/85 (85.88%), Query Frame = 1
Query:   40 SSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGG 294
            S IP +A KLL+QSIFNNTGGEVV+ +  KTE+LGTPTETAILE GL LGG FQ ER++ K++KVEPFNS KK+MGVVIELPEGG
Sbjct:  487 SEIPESAVKLLIQSIFNNTGGEVVVNKHGKTELLGTPTETAILELGLSLGGKFQEERKSYKVIKVEPFNSTKKRMGVVIELPEGG 571          
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA1_ORYSJ (Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.572e-27
Identity = 61/100 (61.00%), Postives = 75/100 (75.00%), Query Frame = 1
Query:    1 KEVDNSKGTPAFGSSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGGFR 300
            KEV+N K      S +P    K LL+SIFNNTGGEVVI +  K +ILGTPTETA+LEF L LGG+F+A+R  +KIVK+EPFNS KK+M VV++LP GG R
Sbjct:  478 KEVNNPKNASDLCSELPETVVKTLLESIFNNTGGEVVIDQDGKYQILGTPTETALLEFALSLGGNFKAKRDETKIVKMEPFNSTKKRMCVVLKLPGGGCR 577          
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA2_ORYSJ (Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.407e-25
Identity = 56/96 (58.33%), Postives = 70/96 (72.92%), Query Frame = 1
Query:   13 NSKGTPAFGSSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGGFR 300
            N+  TP   S+ P  A + LL+SIFNNT GEVV  +  K +ILGTPTETA+LEF LLL GD + ++  SKIVKVEPFNS KK+M  ++ELP GG+R
Sbjct:  486 NNPQTPNMSSNFPEVAVETLLESIFNNTSGEVVTNQDGKYQILGTPTETALLEFALLLDGDCKEKQLGSKIVKVEPFNSTKKRMSTILELPGGGYR 581          
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA4_ARATH (Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.615e-21
Identity = 51/90 (56.67%), Postives = 62/90 (68.89%), Query Frame = 1
Query:   31 AFGSSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGGFR 300
            +F   +       LLQ IF NTG EVV  +   T+ILG+PTE AILEFGLLLGGDF  +R+  KI+K+EPFNS KK+M V+I LP GG R
Sbjct:  482 SFELELSEEVQSTLLQGIFQNTGSEVVKDKDGNTQILGSPTERAILEFGLLLGGDFNTQRKEHKILKIEPFNSDKKKMSVLIALPGGGAR 571          
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA11_ARATH (Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.182e-18
Identity = 46/89 (51.69%), Postives = 60/89 (67.42%), Query Frame = 1
Query:   34 FGSSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGGFR 300
            F  ++      +L+Q+IF NTG EVV  +  KT+ILG+PTE AILEFGLLLGGD   +R+  KI+K+EPFNS KK+M V+     G  R
Sbjct:  480 FQLNLSEQVKNILIQAIFQNTGSEVVKDKEGKTQILGSPTERAILEFGLLLGGDVDTQRREHKILKIEPFNSDKKKMSVLTSHSGGKVR 568          
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA4_ORYSJ (Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.850e-18
Identity = 51/100 (51.00%), Postives = 62/100 (62.00%), Query Frame = 1
Query:    1 KEVDNSKGTPAFGSSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGGFR 300
            K V ++  +    S + ++   LLLQ IF NT  EVV  +  K  +LGTPTE AILEFGL L GD  AE +A   VKVEPFNS KK+M V+I LP G  R
Sbjct:  478 KSVTSNTISGELNSVVSSSTLSLLLQGIFENTSAEVVKEKDGKQTVLGTPTERAILEFGLGLKGDHDAEYRACTKVKVEPFNSVKKKMAVLISLPNGTSR 577          
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA5_ORYSJ (Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 7.020e-17
Identity = 50/100 (50.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:    1 KEVDNSKGTPAFGSSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGGFR 300
            K V ++  +    S + +    LLLQ IF NT  EVV  +  K  +LGTPTE AILEFGL L G   AE  A   VKVEPFNS KK+M V+I LP G  R
Sbjct:  456 KSVTSNTISGELNSVVSSRTLSLLLQGIFENTSAEVVKEKDGKQTVLGTPTERAILEFGLGLEGVHDAEYSACTKVKVEPFNSVKKKMAVLISLPSGTSR 555          
BLAST of CB250264 vs. ExPASy Swiss-Prot
Match: ACA3_ORYSJ (Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.550e-16
Identity = 45/98 (45.92%), Postives = 61/98 (62.24%), Query Frame = 1
Query:    7 VDNSKGTPAFGSSIPAAASKLLLQSIFNNTGGEVVIGEGNKTEILGTPTETAILEFGLLLGGDFQAERQASKIVKVEPFNSAKKQMGVVIELPEGGFR 300
            + N+KG     SS+    +K+LL+ +F+ +G EVV G+  +  I+GTPTETAILEFGL +    + E   +  +KVEPFNS KK M VVI  P  G R
Sbjct:  484 MSNAKGFDQLTSSMSETFAKVLLEGVFHCSGSEVVRGKDGRHTIMGTPTETAILEFGLAVEKRARIEHTGAGKLKVEPFNSVKKTMAVVIASPSAGGR 581          
The following BLAST results are available for this feature:
BLAST of CB250264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ACA1_ARATH9.750e-3573.00Calcium-transporting ATPase 1, chloroplastic OS=Ar... [more]
ACA7_ARATH1.721e-3171.58Putative calcium-transporting ATPase 7, plasma mem... [more]
ACA2_ARATH5.537e-3074.12Calcium-transporting ATPase 2, plasma membrane-typ... [more]
ACA1_ORYSJ2.572e-2761.00Calcium-transporting ATPase 1, plasma membrane-typ... [more]
ACA2_ORYSJ2.407e-2558.33Calcium-transporting ATPase 2, plasma membrane-typ... [more]
ACA4_ARATH1.615e-2156.67Calcium-transporting ATPase 4, plasma membrane-typ... [more]
ACA11_ARATH2.182e-1851.69Putative calcium-transporting ATPase 11, plasma me... [more]
ACA4_ORYSJ2.850e-1851.00Probable calcium-transporting ATPase 4, plasma mem... [more]
ACA5_ORYSJ7.020e-1750.00Probable calcium-transporting ATPase 5, plasma mem... [more]
ACA3_ORYSJ4.550e-1645.92Calcium-transporting ATPase 3, plasma membrane-typ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0032 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ041 similar to calcium-transporting ATPase1 (acc# NP_683331), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250264 ID=CB250264|Name=CB250264|organism=Citrus sinensis|type=EST|length=301bp
AAAGAAGTTGACAACTCCAAGGGGACTCCTGCATTTGGCTCTTCAATTCC
CGCTGCTGCTTCAAAATTATTACTTCAATCAATATTTAACAACACGGGGG
GAGAAGTTGTCATTGGCGAGGGCAACAAAACTGAGATACTGGGAACGCCC
ACTGAAACTGCTATTTTAGAGTTTGGGTTGCTGCTTGGTGGGGATTTCCA
AGCCGAACGACAGGCATCAAAAATTGTGAAAGTTGAACCTTTTAACTCTG
CGAAGAAGCAAATGGGAGTAGTTATAGAGCTTCCTGAAGGGGGATTCCGG
G
back to top