CB250268

Overview
NameCB250268
Unique NameCB250268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length275
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250268 vs. ExPASy Swiss-Prot
Match: MYST1_ARATH (Probable MYST-like histone acetyltransferase 1 OS=Arabidopsis thaliana GN=HAG4 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.497e-35
Identity = 72/91 (79.12%), Postives = 74/91 (81.32%), Query Frame = 3
Query:    3 YVHYTEFNRRLDEWVKLEQLDLXXXXXXXXXXXXXXXXXLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIETW 275
            YVHYTEFNRRLDEW+KLEQLDL                 LKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELG+YEIETW
Sbjct:   97 YVHYTEFNRRLDEWIKLEQLDLDSVECALDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGKYEIETW 187          
BLAST of CB250268 vs. ExPASy Swiss-Prot
Match: MYST2_ARATH (MYST-like histone acetyltransferase 2 OS=Arabidopsis thaliana GN=HAG5 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.289e-34
Identity = 68/91 (74.73%), Postives = 73/91 (80.22%), Query Frame = 3
Query:    3 YVHYTEFNRRLDEWVKLEQLDLXXXXXXXXXXXXXXXXXLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIETW 275
            YVHYTEFNRRLDEW +L+QLDL                 LKMTRHQKRKIDETH+EGHEELDAASLREHEEFTKVKNI+TIELG+YEIETW
Sbjct:   97 YVHYTEFNRRLDEWTQLDQLDLDSVECAVDEKVEDKVTSLKMTRHQKRKIDETHIEGHEELDAASLREHEEFTKVKNISTIELGKYEIETW 187          
BLAST of CB250268 vs. ExPASy Swiss-Prot
Match: MYST1_ORYSJ (Putative MYST-like histone acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os07g0626600 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.401e-33
Identity = 72/92 (78.26%), Postives = 73/92 (79.35%), Query Frame = 3
Query:    3 YVHYTEFNRRLDEWVKLEQLDLXXXXXXXXXXXXXXXXXLKMTRHQKRKIDETHVE-GHEELDAASLREHEEFTKVKNIATIELGRYEIETW 275
            YVHYTEFNRRLDEWVKLEQLDL                 LKMTRHQKRKIDETHVE GHEELDAASLREHEEFTKVKNIA IELGRYEI+TW
Sbjct:  101 YVHYTEFNRRLDEWVKLEQLDLETVETDVDEKVEDKATSLKMTRHQKRKIDETHVEQGHEELDAASLREHEEFTKVKNIAKIELGRYEIDTW 192          
BLAST of CB250268 vs. ExPASy Swiss-Prot
Match: MYST1_RAT (Probable histone acetyltransferase MYST1 OS=Rattus norvegicus GN=Myst1 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.481e-11
Identity = 43/103 (41.75%), Postives = 53/103 (51.46%), Query Frame = 3
Query:    3 YVHYTEFNRRLDEWVKLEQL-------DLXXXXXXXXXXXXXXXXXLKMTRHQKRKIDE-THVE-GHEELD---AASLREHEEFTKVKNIATIELGRYEIETW 275
            YVHY  FNRRLDEWV   +L       D                   K+TR+QKRK DE  HV+  + E+D   AA  +EHE  TKVK +  I +G YEI+ W
Sbjct:   90 YVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAW 192          
BLAST of CB250268 vs. ExPASy Swiss-Prot
Match: MYST1_MOUSE (Probable histone acetyltransferase MYST1 OS=Mus musculus GN=Myst1 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.481e-11
Identity = 43/103 (41.75%), Postives = 53/103 (51.46%), Query Frame = 3
Query:    3 YVHYTEFNRRLDEWVKLEQL-------DLXXXXXXXXXXXXXXXXXLKMTRHQKRKIDE-THVE-GHEELD---AASLREHEEFTKVKNIATIELGRYEIETW 275
            YVHY  FNRRLDEWV   +L       D                   K+TR+QKRK DE  HV+  + E+D   AA  +EHE  TKVK +  I +G YEI+ W
Sbjct:   90 YVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAW 192          
BLAST of CB250268 vs. ExPASy Swiss-Prot
Match: MYST1_HUMAN (Probable histone acetyltransferase MYST1 OS=Homo sapiens GN=MYST1 PE=1 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 7.481e-11
Identity = 43/103 (41.75%), Postives = 53/103 (51.46%), Query Frame = 3
Query:    3 YVHYTEFNRRLDEWVKLEQL-------DLXXXXXXXXXXXXXXXXXLKMTRHQKRKIDE-THVE-GHEELD---AASLREHEEFTKVKNIATIELGRYEIETW 275
            YVHY  FNRRLDEWV   +L       D                   K+TR+QKRK DE  HV+  + E+D   AA  +EHE  TKVK +  I +G YEI+ W
Sbjct:   90 YVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAW 192          
The following BLAST results are available for this feature:
BLAST of CB250268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
MYST1_ARATH1.497e-3579.12Probable MYST-like histone acetyltransferase 1 OS=... [more]
MYST2_ARATH6.289e-3474.73MYST-like histone acetyltransferase 2 OS=Arabidops... [more]
MYST1_ORYSJ1.401e-3378.26Putative MYST-like histone acetyltransferase 1 OS=... [more]
MYST1_RAT7.481e-1141.75Probable histone acetyltransferase MYST1 OS=Rattus... [more]
MYST1_MOUSE7.481e-1141.75Probable histone acetyltransferase MYST1 OS=Mus mu... [more]
MYST1_HUMAN7.481e-1141.75Probable histone acetyltransferase MYST1 OS=Homo s... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0039 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ050 similar to carrot embryonic callus protein 181 (acc# T14282), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250268 ID=CB250268|Name=CB250268|organism=Citrus sinensis|type=EST|length=275bp
ACTATGTCCATTACACCGAGTTCAATAGGAGGCTCGATGAATGGGTGAAG
CTTGAACAACTTGATCTTGATTCGGTAGAAACAGTTGTTGATGAGAAGGT
AGAAGACAAGGTAACAAGCTTAAAAATGACCCGCCATCAAAAACGAAAGA
TTGATGAGACACATGTTGAGGGTCACGAGGAGCTTGACGCTGCCAGTTTG
CGTGAGCATGAAGAATTCACAAAAGTGAAAAACATAGCAACTATAGAACT
TGGAAGATATGAGATAGAGACATGG
back to top